KEGG   Streptococcus pneumoniae INV200: SPNINV200_01360Help
Entry
SPNINV200_01360   CDS       T02073                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPNINV200_01360
Enzymes [BR:snv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SPNINV200_01360
Peptidases [BR:snv01002]
 Cysteine Peptidases
  Family C44
   SPNINV200_01360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138648..140186
Genome map
AA seq 512 aa AA seqDB search
MENTLLNITGSFDMETRNLISYSLTDIFETDKIRIELLGEIYYKNIKLELHEFAGLYKIY
GISLIKNITGMFLIIIFDTKTKELKIFQDITTSYFNLYYTVYGGVFYYSTSLKKVMKLSH
VPVTLNNKKIQEFMRNGFILDSNTLVTEINKLEYFSYISVNNTLRICGIDYNDSNNFTKE
QVLKNWDSMLRESILRVYSEAGEANITLSSGFDSNYILYTLANYTNSSINAFCIGGEKGI
NEIPEVTKIAKFYGINLLVDTVMSQDLEYFPDIVWRLEGSLFECGVILQYYLGRLLFQKG
NTSILCGESADEIMTFKYHSVNYNQFCNDKQKSVYFSYSDYPFYVTNSIVLKKNSLLLHS
FGIHPRYPYKMSEIVEMSKKISDLNDKKEFHKKNCELRFQDSVLDNINSVPGTTHLFSCL
NIQTLVKIILYIFRYNSCMKIFNFRDKELIFFNKIVNGLIQNIEENLEDDIERILKYLYI
CLFNEIFIIKNKVNFFDDVEFNQTLSEFLDKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatactttattgaatatcacaggaagcttcgatatggaaactaggaatctaatt
agttattctttaactgatatctttgaaacagataaaataagaattgaacttcttggagaa
atttattataaaaatataaagttggaattgcatgaattcgctggattgtataagatttat
ggaattagcttaataaagaatattaccggaatgtttttaattataatttttgatacgaag
acaaaagaattaaaaatttttcaagatataacgacttcatactttaatttatactatact
gtttatggaggtgtgttctattatagtacatctttaaagaaagtgatgaagttatctcat
gttcccgttaccttaaataacaaaaaaatacaagaatttatgagaaatggatttatttta
gattcaaatactttagtaaccgaaattaataaattagaatatttctcttacatttctgta
aataatactcttcgtatatgtggtattgattataatgattcaaacaattttactaaagaa
caagtattaaagaattgggactctatgctacgtgaatctatattaagagtgtatagtgaa
gcaggagaggctaatattacactatcatctggttttgattcaaattatatattatataca
ttagcgaattatacgaattcttcaattaatgcattttgcataggaggagaaaaaggaatt
aatgagattcctgaagtaactaaaattgcaaaattttatggtataaatttattagttgat
actgtaatgagccaagatttagaatattttcccgatatagtatggagattggaaggaagt
ctctttgaatgtggtgtcatactgcagtactatttaggcaggttgttgttccaaaaaggg
aacacaagtattctttgtggcgagtcagcggatgaaataatgacttttaagtatcattct
gtgaactacaatcaattttgtaatgataaacagaagtcagtatattttagttattccgac
tatccattttatgttacaaattcaattgttttaaagaaaaatagcctacttttgcatagt
tttggcattcatcctagatatccatataaaatgtctgagattgttgaaatgtctaaaaaa
atatcagatctaaacgataaaaaagaatttcacaaaaagaactgtgagttgaggtttcaa
gatagtgttcttgataacataaatagtgtcccgggtacaactcatttatttagttgttta
aatattcaaacattagtaaaaattattttatatatttttcgatacaacagttgtatgaaa
atatttaattttagagataaagagcttatcttttttaataagattgtaaatgggctgata
caaaatattgaggagaatttagaggatgatattgaaaggatattgaaatatttatatata
tgtttatttaacgaaatattcattattaagaataaggtgaatttttttgatgatgtggaa
tttaatcagacacttagtgaatttttagataaattgtag

DBGET integrated database retrieval system