KEGG   Streptococcus pneumoniae INV200: SPNINV200_02710Help
Entry
SPNINV200_02710   CDS       T02073                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPNINV200_02710 (folP)
Enzymes [BR:snv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPNINV200_02710 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269592..270566
Genome map
AA seq 324 aa AA seqDB search
MMKILEGVTDMSSKANHAKTVICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGADLVN
DITGLMGDEKMAHVVAKAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQTFTEKELADFET
LPIEDLMVAFFERALARAAEAGIAPENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYPI
FLGVSRKRFVINILEESGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVASHR
MAVEIASAIRLADEAENLDLKQYK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaatccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gttatttgcggaattatcaatgtaaccccagactccttttcggacggtggtcaatttttt
gctcttgagcaggcgctccagcaggctcgtaaattgatagcagaaggagccagtatgctc
gatatcggcggagaatcgactcggccgggaagtagctatgttgagatagaagaggaaatc
cagcgtgttgttccagtgatcaaagcgattcgcaaggaaagtgatgtcctcatctctatt
gatacttggaagagtcaagtagcagaggctgctttggctgctggtgccgatctagtcaat
gatatcactggtctcatgggtgatgaaaaaatggcccatgtggttgctaaagctggagcg
aaagtggtcatcatgtttaacccagttatggctcgacctcagcatcctagttcgcttatc
ttccctcattttggctttggtcaaacctttacagaaaaagagttagctgactttgaaaca
ttgccaatcgaagacttgatggtggctttctttgaacgagcactagcgagagcggcagaa
gctggtattgcaccagaaaatatcctgttggatccaggaattggctttggtctgaccaag
aaagaaaatcttctccttttacgggacctggataaactacatcagaagggctatccaatc
tttctcggagtgtcgcgcaagcgatttgtcatcaatatccttgaagaaagtgggtttgaa
gtcaatcctgagacagagcttggtttccgcaatcgggacacggcttcggctcatgtaacc
agtatcgctgcaagacagggtgtagaagtggtgcgcgtgcatgacgtagctagtcacagg
atggcagttgaaattgcctctgccattcgtctggctgatgaagcggaaaatttagattta
aaacaatataaataa

DBGET integrated database retrieval system