KEGG   Streptococcus pneumoniae INV200: SPNINV200_05900Help
Entry
SPNINV200_05900   CDS       T02073                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNINV200_05900 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNINV200_05900 (glkA)
   00052 Galactose metabolism
    SPNINV200_05900 (glkA)
   00500 Starch and sucrose metabolism
    SPNINV200_05900 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNINV200_05900 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPNINV200_05900 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SPNINV200_05900 (glkA)
Enzymes [BR:snv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPNINV200_05900 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608710..609669
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactcggt
actggtgttggtggtggtattgtcgcagaaggcaaattgcttcatggtgttgctggtgca
gcaggtgaacttggtcatatcactgttgactttgaccaaccaatctcatgtacttgtggt
aaaaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataacggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

DBGET integrated database retrieval system