KEGG   Streptococcus pneumoniae INV200: SPNINV200_14800Help
Entry
SPNINV200_14800   CDS       T02073                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
snv00010  Glycolysis / Gluconeogenesis
snv00260  Glycine, serine and threonine metabolism
snv00680  Methane metabolism
snv01100  Metabolic pathways
snv01110  Biosynthesis of secondary metabolites
snv01120  Microbial metabolism in diverse environments
snv01130  Biosynthesis of antibiotics
snv01200  Carbon metabolism
snv01230  Biosynthesis of amino acids
Module
snv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
snv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNINV200_14800 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPNINV200_14800 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPNINV200_14800 (gpmA)
Enzymes [BR:snv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPNINV200_14800 (gpmA)
Membrane trafficking [BR:snv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SPNINV200_14800 (gpmA)
Exosome [BR:snv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPNINV200_14800 (gpmA)
  Exosomal proteins of melanoma cells
   SPNINV200_14800 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBW35113
Position
complement(1506157..1506849)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIKFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcaaatttgaccaagcttacacttcagtattgaaacgt
gctatcaaaacaactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaataaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaatatggaccgtgatgatgagcactcagctcacacagaccgtcgttatgcttca
cttgacgactcagtaatcccagatgctgaaaacttgaaagtgactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgatgag
atcatggacgtggaaatccctaacttcccaccattggtattcgaattcgacgaaaaattg
aacgttgtttctgaatattaccttggaaaataa

DBGET integrated database retrieval system