KEGG   Streptococcus pneumoniae INV200: SPNINV200_16390Help
Entry
SPNINV200_16390   CDS       T02073                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
snv00260  Glycine, serine and threonine metabolism
snv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snv01100  Metabolic pathways
snv01110  Biosynthesis of secondary metabolites
snv01130  Biosynthesis of antibiotics
snv01230  Biosynthesis of amino acids
Module
snv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPNINV200_16390 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPNINV200_16390 (trpB)
Enzymes [BR:snv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SPNINV200_16390 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBW35272
Structure
PDB: 

Jmol
Position
complement(1668090..1669313)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDMTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGTEAAGLGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctatcgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccaactcttgcgccagtatgtggggcgggaaact
cctctttactacgcaaaaaacttgacccagcatattggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttaggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaaccggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgcatggagcttttgggagccaaggtc
gaggctgtaacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatcgacgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaatcgttcgtgacttccaaagtgtcatcggtcgcgaagctaaacaacagtat
cgcgatatgacaggtcaaaatctgcccgatgctctagtagcctgtgttggtggtggatct
aatgctattgggctcttccatccctttgtagaagatgagtcagtagctatgtatggaact
gaagcagcagggcttggtgtggatacggagcaccacgctgctaccttgaccaagggtcgt
ccgggtgttcttcacggttctctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagctttggaatctagccatgctatc
gcttttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtctgccta
tcaggtcgtggggacaaggatgtggttcaagtcaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system