KEGG   Streptococcus pneumoniae INV200: SPNINV200_18380Help
Entry
SPNINV200_18380   CDS       T02073                                 

Gene name
adhE
Definition
(RefSeq) aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1)
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPNINV200_18380 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNINV200_18380 (adhE)
   00620 Pyruvate metabolism
    SPNINV200_18380 (adhE)
   00650 Butanoate metabolism
    SPNINV200_18380 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SPNINV200_18380 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPNINV200_18380 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPNINV200_18380 (adhE)
   00626 Naphthalene degradation
    SPNINV200_18380 (adhE)
Enzymes [BR:snv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPNINV200_18380 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SPNINV200_18380 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1865461..1868112)
Genome map
AA seq 883 aa AA seqDB search
MADKKTVTPEEKKLVAEKHVDELVQKALVALEEMRKLDQEQVDYIVAKASVAALDAHGEL
ALHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVAEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPATWIAEQAGFTVPEGTNILAAECKEVGENEPLTREKLSPV
IAVLKSESREDGITKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIQYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
NRGTEIMRAFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPASTPEEGVESYAKAVYELGERIGIQMNFRDQGIDEKEWKEHSR
KLAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactgtgacaccagaggaaaagaaactcgttgctgaaaaacacgta
gatgagttggttcaaaaagctctagttgcccttgaagaaatgcgtaaattggatcaagaa
caagttgactacatcgttgccaaagcatcagtagcagctttggatgcccacggagaattg
gctttacatgcctttgaagaaacaggacgtggtgtatttgaagacaaagcaactaagaac
ttgtttgcctgtgaacacgtagtaaacaacatgcgccacactaagacagttggcgttatc
gaagaagacgatgtaacaggattgactcttattgctgaaccagttggtgttgtttgtggt
attactccaacaacaaacccaacatcaacagcaatcttcaaatcattgatttcattgaag
acacgtaacccaatcgtctttgccttccatccatcagcacaagaatcatctgctcatgca
gctcgtatcgtccgcgatgcagctatcgcagctggtgctcctgaaaactgtgtgcaatgg
attactcaaccatctatggaagcaacaagtgcccttatgaaccacgaaggtgttgcgaca
atccttgcaacaggtggtaatgccatggttaaggcggcttattcatgtggtaaaccagct
cttggggtaggtgccggaaacgttccagcttatgttgaaaaatcagcaaacattcgtcaa
gcagcacacgatatcgtcatgtctaaatcatttgataacggtatggtctgtgcatctgaa
caagcagttatcattgataaagaaatttacgatgaatttgtagcagagttcaaatcttac
cacacttactttgtaaacaaaaaagaaaaagctcttcttgaagagttctgcttcggcgtc
aaagcaaacagcaaaaactgtgctggtgcaaaattgaacgctgacatcgttggtaaacca
gcaacttggattgcagaacaagcaggatttacagttccagaaggaacaaacattcttgct
gcagaatgtaaagaagttggcgaaaatgagccattgactcgtgaaaaattgtcaccagtt
attgcagttttgaaatctgaaagccgtgaagatggtattactaaggctcgtcaaatggtt
gaatttaacggtcttggacactcagcagctatccacacagctgacgaagaattgactaaa
gaatttggtaaagctgttaaagctattcgtgttatctgtaactcaccttctacttttggt
ggtatcggggacgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactcagttggggataacgttagtgccattaacctcttgaatatcaaaaaagtc
ggaagacggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattcaataccttcaaaaatgtcgtgacgttgaacgtgtcatgatcgttactgac
catgccatggtagagcttggtttccttgatcgtatcatcgaacaactggaccttcgtcgc
aataaggttgtttaccaaatctttgcggatgtagaaccggatccagatatcacaactgta
aaccgtggtactgagattatgcgtgccttcaaaccagataccatcatcgcactcggtggt
gggtctccaatggatgctgccaaagtaatgtggctcttctacgagcaaccagaagtggac
ttccgtgaccttgtccaaaaattcatggatatccgtaaacgtgccttcaagttcccattg
cttggtaagaagactaaattcatcgcgattccaactacatctggtacaggatctgaagta
acaccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgctgactac
tcattgacaccaactgtggcaatcgtagatcctgctttggtattgacagttccaggattt
gttgctgctgatactggtatggacgtattgactcacgcgacagaagcatacgtatcacaa
atggctagtgactacactgatggtttagcacttcaagccattaaattggtctttgaaaat
ctcgaaagctcagttaagaatgcagacttccactcacgtgagaaaatgcataacgcttca
acaatcgctggtatggcctttgccaatgccttcctaggtatttctcactcaatggcccat
aagattggtgcgcaattccacacaatccacggtcgtacaaatgctatcttgcttccatac
gttatccgttacaacggtacacgtccagctaagacagcaacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgcacgcatgcttggacttccagcttctact
ccagaagaaggggttgaatcttacgcaaaagctgtctacgaactcggtgaacgtattggg
atccaaatgaattttagagaccaaggaattgacgaaaaagaatggaaagaacattctcgt
aaattagccttcctggcttatgaagaccaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcatactatggctacaaagaaagaccagga
cgccgtaaataa

DBGET integrated database retrieval system