KEGG   Streptococcus pneumoniae INV200: SPNINV200_18790Help
Entry
SPNINV200_18790   CDS       T02073                                 

Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SPNINV200_18790
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPNINV200_18790
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPNINV200_18790
Enzymes [BR:snv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPNINV200_18790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1902132..1903616)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLNFNKLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGDKINFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNDAVKTAELMNALNSQGQYELT
NFDAEILDLFAAEYATEEETAAEIKRVYESDSYIEDPHTAVASAVYRKYQATTGDATKTV
IASTASPYKFPVVAVEALTGKVGLTDFEALAQLHEISGVAVPPAVDGLETAPVRHKTIVA
AADMQVAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttgaactttaacaaattgaaagatgcttcttaccaggaagttgctaagctagttttg
tcagcatttttagatgactttacagctgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcaaactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctcttcgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacaaattgtttat
tatgtttatgcttacgctcaattggtcaagactggtgagatcgtggctggtgataagatt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
atcggtctcccagttggtaaattgatctgtgcttcaaatgacaacaatgttttgacagac
ttcttcaagacacgtgtctatgacaagaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgtttgattttccatcttttggggaatgat
gcggttaagacggctgaactcatgaatgctttgaatagccaaggtcaatatgagttgact
aattttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaact
gcggcagaaatcaagcgtgtttatgagtcagattcttatatcgaggatcctcatacagcg
gttgcctcagcagtgtatagaaaataccaggcgactactggagatgcgactaagacagtg
attgcttcaacagctagtccctacaagttcccagtagttgcagtagaagcgctaacaggg
aaagttggcttgactgattttgaagctttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgagacagctcctgttcgtcacaagacaatagtggca
gctgctgacatgcaagtagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system