KEGG   Streptococcus pneumoniae INV200: SPNINV200_19040Help
Entry
SPNINV200_19040   CDS       T02073                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
snv  Streptococcus pneumoniae INV200
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPNINV200_19040 (hasC)
   00052 Galactose metabolism
    SPNINV200_19040 (hasC)
   00500 Starch and sucrose metabolism
    SPNINV200_19040 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNINV200_19040 (hasC)
Enzymes [BR:snv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPNINV200_19040 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1935081..1935980
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMDDYERTHASTIAVMPVPHDEVSAYGVIAPQ
GEGKDGLYSVETFVEKPAPEDAPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAID
TLNKTQRVFAREFKGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagttatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaggctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccacttcgattcaaacttcgaattggaatataacctcaaa
gaaaaagggaaaacagatcttttgaagctagttgatgaaacaactggcatgcgtctgcat
tttatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgaa
aaggctgttccacttaccaaacaactcatggatgactacgagcgtacccacgcgtctact
atcgctgtcatgccagtccctcatgacgaagtatctgcttacggggttattgctccgcaa
ggcgaaggaaaagatggtctttacagtgttgaaacctttgttgaaaaaccagctccagag
gacgctcctagcgaccttgctattatcggacgctacctcctcacgcctgaaatttttgag
attctcgaaaagcaagctccaggtgcaggaaatgaaattcagctgacagatgcaatcgac
accctcaataaaacacaacgtgtatttgctcgtgagttcaaaggggctcgttacgatgtc
ggagacaagtttggcttcatgaaaacatccatcgactacgccctcaaacacccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system