KEGG   Streptococcus pneumoniae INV200: SPNINV200_20390Help
Entry
SPNINV200_20390   CDS       T02073                                 

Definition
ABC transporter ATP-binding protein
Organism
snv  Streptococcus pneumoniae INV200
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2081296..2082918
Genome map
AA seq 540 aa AA seqDB search
MLTVSDVSLRFSDRKLFDDVNIKFTEGNTYGLIGANGAGKSTFLKILAGDIEPTTGHISL
GPDERLSVLRQNHFDYEDERAIDVVIMGNEKLYSIMKEKDAIYMKEDFSDEDGVRAAELE
GEFAELGGWEAESEASQLLQNLNIPEELHYQNMSELANGEKVKVLLAKALFGKPDVLLLD
EPTNGLDIQSITWLEDFLIDFDNTVIVVSHDRHFLNKVCTHMADLDFGKIKLYVGNYDFW
KESSELAAKLLADRNAKAEEKIKQLQEFVARFSANASKSRQATSRKKMLDKIELEEIVPS
SRKYPFINFKAEREIGNDLLTVENLTVKIDGETILDNISFILRPDDKTALIGQNDIQTTA
LIRAIMGDIDYEGTVKWGVTTSQSYLPKDNSADFAGGESILDWLRQFASKEEDDNTFLRG
FLGRMLFSGDEVNKPVNVLSGGEKVRVMLSKLMLLKSNVLVLDDPTNHLDLESISSLNDG
LKNFKESIIFASHDHEFIQTLANHIIVLSKNGVIDRIDETYDEFLENAEVQAKVKELWKD
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttgcttacagtatctgatgtttcactacgttttagtgatcgcaaactttttgatgatgtc
aatatcaaatttacagaaggaaatacttacggattaatcggtgctaatggtgccggaaaa
tcaacctttttaaaaattttagctggagatatcgaacctactactggtcacatctctctt
ggtccagatgaacgtctctctgttcttcgtcaaaatcactttgactacgaagatgaacgt
gccattgatgtcgttatcatgggaaatgaaaaactttatagcatcatgaaagagaaagat
gctatctacatgaaggaagatttctcagacgaggacggggttcgtgctgccgaactcgaa
ggagagtttgccgaacttggaggttgggaagcagagagtgaagcctctcaactacttcaa
aacctaaacattccagaagaattacactaccaaaacatgagcgaattggccaacggtgaa
aaagtaaaggttctcctcgccaaagcactttttggtaaaccagatgttcttctcttggac
gagcctactaacggtttggatatccaatcgattacttggttagaagacttcttaattgac
tttgataacacagttatcgtagtatcccacgaccgtcacttcttaaacaaagtttgtact
cacatggccgaccttgactttggaaaaatcaaactctatgtcggaaactacgacttctgg
aaggaatcttctgagcttgctgctaaattgctagcagaccgtaatgctaaagcagaagaa
aaaattaaacaattgcaagaattcgttgctcgtttctctgccaatgcttctaagtcaagg
caggcaacatcacgtaagaaaatgcttgataagattgagctagaagagattgtaccatct
agtcgtaaatatccatttatcaactttaaagcggaacgtgagattggtaatgatctcttg
acagtagaaaatctaactgtaaagattgatggtgaaactatcttggataatattagtttc
atcttgcgtccagatgataagacagcacttattggacaaaatgatattcaaacaactgca
ttaattcgtgcaatcatgggagatattgactatgaaggaactgtcaagtggggagttaca
actagtcaatcttacctaccaaaagataactcagctgattttgcaggaggagaatcaatt
cttgactggttgcgtcaattcgcaagtaaagaagaagatgacaatactttcctacgtggc
ttcctcggccgtatgctcttctctggagatgaagttaacaaacctgtaaatgtcttgtca
gggggagaaaaagttcgtgtcatgctttcaaaactcatgctcttaaaatcaaatgtcctt
gtacttgatgatccaacaaatcacttggacttggaatctatctcaagcttgaatgatgga
ttgaaaaactttaaagaatcaatcatctttgccagccatgaccacgaatttattcaaact
ttggctaaccatatcattgtcttatctaaaaatggcgtcattgaccgtatcgatgaaacc
tacgatgaattcctagaaaatgcagaagtacaagcaaaagttaaagaactttggaaagac
taa

DBGET integrated database retrieval system