KEGG   Streptococcus pneumoniae OXC141: SPNOXC_00950Help
Entry
SPNOXC_00950      CDS       T02074                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SPNOXC_00950 (strH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPNOXC_00950 (strH)
Enzymes [BR:snx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SPNOXC_00950 (strH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(93047..96973)
Genome map
AA seq 1308 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSEN
RTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEK
ETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPATEAGKERAATV
NEKLAKKKIVSIDAGRKYFSPEQLKKIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITAN
GKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDA
ILNAMKELGIQNPNFSYFGKESARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLD
EYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIY
YNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQG
WYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANA
NAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAI
AKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELG
YSDVHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVT
ELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNF
VKALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAK
ERGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGD
WYYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYK
EEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLN
RNKQAELDILVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKK
ENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTH
KGDESGLAPTTEVKPRLDIQEEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVST
SADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEILSQPAPAEE
SKALPQDPAPVVIEKKLPETGTHDSAGLVVAGLMATLAAYGLTKRKED
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactcctact
actacagaaaaccaaccgaccatccatacggtttctgattcccctcaatcatccgaaaat
cggactgaggaaacacctaaagcagagcttcaaccagaagctccaaaaactgtagaaaca
gaaactccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagag
gaagttagttcaactcctagtgataaagcagaagtggtaactccaacttctgctgaaaaa
gaaactgctaataaaaaggcagaagaagctagccctaaaaaggaagaagcgaaagaggtt
gattctaaagagtcaaatacagacaagactgacaaggataaaccagctaaaaaagatgaa
gcgaaagcagaggctgacaaaccggcaacagaggcaggaaaggaacgtgctgcaactgta
aatgaaaaactagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctca
ccagaacagctcaagaaaatcatcgataaagcgaaacattatggctacactgatttacac
ctattagtcggaaatgatggactccgtttcatgttggacgatatgagcatcacagctaac
ggcaagacctatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattat
tacaacgatccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactat
gccaaagataaaggtatcggtctcattccgacagtaaatagtcctggtcacatggatgcg
attctcaatgccatgaaagaattgggaatccaaaaccctaactttagctattttgggaag
gaatcagcccgtactgtcgatcttgacaacgaacaagctgtcgcttttacaaaagccctt
atcgacaagtatgctgcttatttcgcgaaaaagactgaaatcttcaacatcggacttgat
gaatatgccaatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatac
tatccaaacgaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgac
ctcgctcgtattgtaaaatcgcacggtctcaaaccaatggcctttaacgacggtatctac
tacaatagcgacacaagctttggtagttttgacaaagacatcatcgtttctatgtggact
ggtggttggggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaa
atccttaataccaatgatgcttggtactacgttcttggacgaaacgctgatggccaaggc
tggtacaatctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtacca
aaaacagaaggagctgatatcccaatcatcggtggtatggtagctgcttgggctgacact
ccatctgcacgttattcaccatcacgcctcttcaaactcatgcgtcattttgcaaatgcc
aacgctgaatacttcgcagctgattatgaatctgcagagcaagcacttaacgaggtacca
aaagacctgaaccgttatactgcagaaagcgtcacggccgtaaaagaagctgaaaaagct
attcgctctctcgatagcaaccttagccgtgcccaacaagatacgattgatcaagccatt
gctaaacttcaagaaactgtcaacaacttgaccctcacgcctgaagctcaaaaagaagaa
gaagctaaacgtgaggttgaaaaacttgccaaaaacaaggtaatctcaatcgatgctgga
cgcaaatactttactctgaaccagctcaaacgcatcgtagacaaggccagtgagctcgga
tattctgatgtccatctccttctaggaaatgacggacttcgctttctactcgatgatatg
accattactgccaacggaaaaacctatgctagtgatgacgttaaaaaagctattatcgaa
ggaactaaagcttactacgacgatccaaacggtactgcactaacacaggcagaagtgaca
gagctaattgaatacgctaaatctaaggacatcggtctcatcccagctattaacagtcca
ggtcacatggatgctatgctggttgccatggaaaaattaggtattaaaaatcctcaagcc
cactttgataaagtttcaaaaacaactatggacttgaaaaacgaagaagcgatgaacttt
gtaaaagccctcatcggtaaatacatggacttctttgcaggtaaaacaaagattttcaac
tttggtactgacgaatacgccaacgatgcgactagtgcccaaggctggtactacctcaag
tggtatcaactctatggcaaatttgccgaatatgccaacaccctcgcagctatggccaaa
gaaagagggcttcaaccaatggccttcaacgatggcttctactatgaagacaaggacgat
gttcagtttgacaaagatgtcttgatttcttactggtctaaaggctggtggggatataac
ctcgcatcacctcaatacctagcaagcaaaggctataaattcttgaataccaacggtgac
tggtactacattcttggtcaaaaaccagaagatggtggtggtttcctcaagaaagctatt
gagaatactggaaaaacaccattcaatcaactagcttctaccaaatatcctgaagtagat
cttccaacagtcggaagtatgctttcaatctgggcagatagaccaagcgctgagtacaag
gaagaggaaatctttgaactcatgactgcctttgcagaccacaacaaagactacttccgt
gctaattataatgctctccgcgaagaattagctaaaattcctacaaacttagaaggatat
agtaaagaaagtcttgaggcccttgacgcagctaaaacagctctaaattacaacctcaac
cgtaataaacaagctgagcttgacatacttgtagccaacctaaaagccgctcttcaaggc
ctcaaaccagctgcaactcattcaggaagcctggatgaaaatgaagtggctgccaatgtt
gaaaccagaccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaa
gaaaatcctaacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgaa
cgaactcattacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgat
agccaggtaaccaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcac
aagggtgatgaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaa
gaagaagaaattccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaa
acacaagtcattactaagggtgtcaatggacatcgtagcaacttctactctgtgagcact
tctgccgatggtaaggaagtgaaaacacttgtaaatagtgtcgtagcacaggaagccgtt
actcaaatagtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagcc
gctattgctgaagaaaaaccaaaactagaaatcctaagccaaccagctcctgctgaggaa
agcaaagctcttcctcaagatccagctcctgtggtaatagagaaaaaacttcctgaaaca
ggaactcacgattctgcaggactagtagtcgcaggactcatggccacactagcagcctat
ggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system