KEGG   Streptococcus pneumoniae OXC141: SPNOXC_03030Help
Entry
SPNOXC_03030      CDS       T02074                                 

Gene name
adhP
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPNOXC_03030 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_03030 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SPNOXC_03030 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPNOXC_03030 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPNOXC_03030 (adhP)
   00626 Naphthalene degradation
    SPNOXC_03030 (adhP)
Enzymes [BR:snx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPNOXC_03030 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(295498..296517)
Genome map
AA seq 339 aa AA seqDB search
MKAVVVNPESTGVAIEEKVLRPLETGEALVEVEYCGVCHTDLHVAHGDFGQVPGRVLGHE
GIGIVKEIAPDVKSLKVGDRVSVAWFFEGCGTCEYCTTGRETLCRTVKNAGYSVDGGMAE
QCIVTADYAVKVPDGLDPAQASSITCAGVTTYKAIKEAKVEPGQWVVLYGAGGLGNLAVQ
YAKKVFNAHVIAVDINNDKLALAKEVGADIVINGLEVEDVARLIKEKTDGGAHSAVVTAV
SKVAFNQAVDSIRAGGRVVAVGLPSEMMELSIVKTVLDGIQVIGSLVGTRKDLEEAFQFG
AEGLVVPVVQKRPVEDAVAIFDEMEKGQIQGRMVLDFTH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgttgtaaatccagaaagcactggtgttgctattgaagaaaaagtactc
cgtccacttgaaactggggaagcacttgtagaagttgaatactgtggcgtttgccacacc
gacctccacgttgctcatggtgactttggtcaagtcccaggacgtgttcttgggcacgaa
ggtatcggtatcgttaaagagattgctccagatgtgaaaagccttaaagtcggtgaccgc
gtcagcgttgcttggttctttgaaggatgtggcacttgcgaatactgtacaactggtcgc
gaaaccctttgccgtacagtgaaaaatgctggctactcagtagacggtggtatggctgaa
caatgtatcgtaactgctgactatgctgtcaaggttcctgacggacttgatccagcccaa
gcttcttctatcacatgtgctggagtaacaacctataaagctatcaaagaagcaaaagtt
gaaccaggccaatgggttgttctttacggtgctggtggacttggtaacctcgctgttcaa
tacgctaaaaaagtattcaatgctcatgttatcgcagtcgatatcaacaatgacaaactt
gcccttgcaaaagaagtaggcgctgacattgtgattaacggcctcgaagttgaagatgta
gctagactcattaaagaaaaaactgatggaggagctcattcagctgtcgtaactgctgtg
tctaaagttgccttcaaccaggctgttgactccattcgtgctggtggtcgcgtcgtcgct
gttggtcttccttctgaaatgatggaactcagcatcgttaaaacagtcctcgatggaatc
caagtcatcggttctcttgtcggaactcgtaaagacttagaagaagccttccaatttggt
gcagaaggtctggtagtcccagttgttcaaaaacgtccagtagaagatgctgttgccatt
ttcgacgaaatggaaaaaggccaaatccaaggacgtatggtactcgacttcacccactaa

DBGET integrated database retrieval system