KEGG   Streptococcus pneumoniae OXC141: SPNOXC_05290Help
Entry
SPNOXC_05290      CDS       T02074                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_05290
Enzymes [BR:snx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPNOXC_05290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522527..523942
Genome map
AA seq 471 aa AA seqDB search
MTIFPDDFLWGGAVAANQVEGAYNEDGKGLSVQDVLPKGGLGEATENPTEDNLKLIGIDF
YHKYKEDISLFSEMGFNVFRTSIAWSRIFPKGDEEEPNEAGLKYYDELFDELHAHGIEPL
VTLSHYETPLYLARKYHGWIDRRMIHFYEKFARTVLERYKDKVKYWLTFNEVNSVLELPF
TSGGIDIPKENLSKQELYQAIHHELVASSLVTKIAREINSEFKVGCMVLAMPAYPMTPNP
KDVWATHEYENLNYLFSDVHVRGYYPNYAKRYFKEHDINIEFAAEDAKLLKNYTVDFLSF
SYYMSVTQSALPTQYNSGEGNIIGGLVNPYLESSEWGWQIDPIGLRIILNRYYDRYQIPL
FIVENGLGAKDQLIKDEFNNLTVQDDYRIQYMKEHLLQVAEALQDGVEIMGYTSWGCIDC
VSMSTAQLSKRYGLIYVDRNDDGNGTFNRYKKMSFTWYKGVIESNGESLFK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaccatttttccagatgattttctttggggtggagctgttgcagctaatcaagtagag
ggagcatataatgaagatggtaagggcttatcagttcaggatgtgttacccaaaggtgga
ttaggagaagcaacagaaaatcctacagaagataacttaaaattgataggtattgatttt
tatcataaatataaggaagatatatccttgttttctgaaatgggctttaatgtttttcgt
acttctattgcatggagtagaatttttccaaaaggagatgaggaagaacctaacgaagct
ggattgaaatattatgatgaattgtttgatgaactacatgctcacgggatagaaccactt
gtaactctttcacactatgagactccattatatttagcaagaaaatatcatggatggatt
gataggagaatgattcatttttatgaaaaatttgctcgaacagttttagaaaggtataaa
gataaagttaaatattggcttacatttaacgaagtaaactctgttttggaattaccgttt
actagtggaggaatagatatacctaaggagaatctttcgaaacaagaattatatcaagct
atacatcatgaattagtcgcctcgagtttggttacaaaaattgctcgtgagattaattca
gagtttaaggtggggtgtatggtattagctatgccagcttatccaatgactccaaatcca
aaagatgtatgggcgactcatgagtatgagaatctaaattatctattttcagatgtgcat
gttagaggttattatccgaattatgcaaaaagatattttaaggaacatgacattaacata
gagtttgcagctgaagatgcaaagttattaaaaaattataccgtagattttttatccttt
agctattacatgagtgtgactcaatctgctcttccaacacagtataattcaggagaaggg
aatattattggtggcttagtaaatccttatttagagtcttctgagtggggatggcaaatt
gatccaattggactacgtataattttaaatagatattatgaccgttatcaaattccatta
tttatagtggaaaacggattaggtgctaaagatcaactaataaaagatgaatttaataac
ttaacagtccaagatgattatagaattcagtatatgaaagaacatttattgcaagtagct
gaagctctacaagatggtgtggaaattatgggctatacgtcttggggatgtattgactgc
gtttctatgtccactgcacaactttctaagaggtacggtctcatttatgttgatcgaaat
gatgatggaaatggcacattcaatcgatataagaaaatgtcctttacttggtataaagga
gtgattgaatcaaatggagaatccttattcaaatag

DBGET integrated database retrieval system