KEGG   Streptococcus pneumoniae OXC141: SPNOXC_06130Help
Entry
SPNOXC_06130      CDS       T02074                                 

Gene name
glkA
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNOXC_06130 (glkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_06130 (glkA)
   00052 Galactose metabolism
    SPNOXC_06130 (glkA)
   00500 Starch and sucrose metabolism
    SPNOXC_06130 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNOXC_06130 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPNOXC_06130 (glkA)
   00524 Butirosin and neomycin biosynthesis
    SPNOXC_06130 (glkA)
Enzymes [BR:snx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SPNOXC_06130 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621453..622412
Genome map
AA seq 319 aa AA seqDB search
MSQKIIGIDLGGTSIKFAILTTAGEIQGKWSIKTNILDEGSHIVDDMIESIQHRLDLLGL
AAADFQGIGMGSPGVVDRDKGTVIGAYNLNWKTLQPIKQKIEKALGIPFFIDNDANVAAL
GERWMGAGDNQPDVVFMTLGTGVGGGIVAEGKLLHGVAGAAGELGHITVDFDQPISCTCG
KKGCLETVASATGIVNLTRRYADEYEGDAALKRLIDNGEEVTAKTVFDLAKEGDDLALIV
YRNFSRYLGIACANIGSILNPSTIVIGGGVSAAGEFLLQGVQKVYDENSFPQVRTSTKLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaagattattgggattgaccttggtggaacttctatcaaatttgcaatctta
acaacagcaggagaaatccaaggaaaatggtcaatcaagaccaacattttggatgaggga
agtcatatcgttgatgatatgattgagtctattcaacatcgtttggacttgcttggattg
gcagcagcggacttccaaggcattggaatgggatcaccaggtgtggttgaccgtgacaaa
gggactgttatcggtgcctacaacttgaactggaaaacccttcaaccaatcaaacaaaag
attgaaaaagctttgggcattccatttttcatcgataatgatgccaacgtagcagctctt
ggtgagcgctggatgggtgctggagataaccaaccagacgttgtctttatgacactcggt
actggtgttggtggcggtatcgtcgcagaaggcaaattgcttcacggtgttgctggtgca
gcaggtgagcttggtcacatcactgttgactttgaccagccaatctcatgtacttgcggt
aagaaaggctgccttgagacagttgcttcagcaacagggattgtcaacttgactcgtcgc
tatgccgatgaatacgaaggcgatgcagccttgaaacgcttgattgataatggagaagaa
gtaactgctaagactgtctttgatctcgcaaaagaaggagacgaccttgctttgattgtt
taccgtaacttctcacgttacttgggaatcgcttgtgctaacattggttcaatcctaaac
ccatcaacaatcgtcatcggtggtggtgtgtcagctgcgggagaattccttctacaaggt
gttcaaaaagtttacgatgaaaatagtttcccacaagtacgcacatctactaaattagct
cttgcaactctaggaaatgacgctggagttatcggagcagcatcacttgtattgcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system