KEGG   Streptococcus pneumoniae OXC141: SPNOXC_08040Help
Entry
SPNOXC_08040      CDS       T02074                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNOXC_08040 (pfk)
   01230 Biosynthesis of amino acids
    SPNOXC_08040 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_08040 (pfk)
   00030 Pentose phosphate pathway
    SPNOXC_08040 (pfk)
   00051 Fructose and mannose metabolism
    SPNOXC_08040 (pfk)
   00052 Galactose metabolism
    SPNOXC_08040 (pfk)
  Energy metabolism
   00680 Methane metabolism
    SPNOXC_08040 (pfk)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SPNOXC_08040 (pfk)
Enzymes [BR:snx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SPNOXC_08040 (pfk)
Protein phosphatases and associated proteins [BR:snx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SPNOXC_08040 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818193..819200
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgctatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagcttcagtaggagacatc
atttctcgtggtggtacttttcttcactcagctcgttacccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaacccg
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system