KEGG   Streptococcus pneumoniae OXC141: SPNOXC_08720Help
Entry
SPNOXC_08720      CDS       T02074                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:snx03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
882651..883475
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVCRSLEKLIIGKKISSIEIRYPKMIKTDLEEFQRELPSQIIESMGRRGKYL
LFCLTDKVLISHLRMEGKYFYYPDQVPERKHAHVFFRFEDGGTLVYEDVRKFGTMELLVP
DLLDAYFISKKLGPEPSEQDFDLQVFQAALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLW
RAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVY
DKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggttgaaaccgtttgtcgtagcttagaaaaattgattatagga
aagaagatttcgagtatagaaattcgctaccccaagatgattaagacggatttggaagag
tttcaaagggaattgcctagtcagattatcgagtcaatgggacgtcgtggaaaatatttg
cttttctgcctgacagacaaggtcttgatttcccatttgcggatggagggcaagtatttt
tattatccagaccaagtgcctgaacgcaagcatgcccatgttttcttccggtttgaagat
gggggcacgcttgtttatgaggatgtacgcaagtttggaaccatggaactcttggtgcct
gaccttttagacgcctactttatttctaaaaaattaggtcctgaaccaagcgaacaagac
tttgatttacaggtctttcaagctgcccttgccaagtccaaaaagcctatcaaatcccat
ctcctagaccagaccttggtagctggacttggcaatatctatgtggatgaggttctctgg
cgagctcaggttcatccagctagaccttcccagactttgacagcagaagaagcgactgcc
attcatgaccagaccattgctgttttgggccaggctgttgaaaaaggcggttccaccatt
cggacctataccaatgcctttggggaagatggaagcatgcaggattttcatcaggtctat
gataagactggtcaagaatgtgtacgctgtggtaccatcattgagaaaattcaactaggc
ggacgaggcacccacttttgtccaaactgtcaaaggagggactga

DBGET integrated database retrieval system