KEGG   Streptococcus pneumoniae OXC141: SPNOXC_13830Help
Entry
SPNOXC_13830      CDS       T02074                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNOXC_13830 (tpi)
   01230 Biosynthesis of amino acids
    SPNOXC_13830 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_13830 (tpi)
   00051 Fructose and mannose metabolism
    SPNOXC_13830 (tpi)
   00562 Inositol phosphate metabolism
    SPNOXC_13830 (tpi)
Enzymes [BR:snx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPNOXC_13830 (tpi)
Exosome [BR:snx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPNOXC_13830 (tpi)
  Exosomal proteins of bladder cancer cells
   SPNOXC_13830 (tpi)
  Exosomal proteins of melanoma cells
   SPNOXC_13830 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1403975..1404733)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSSDLVEAGIAAPALDLTTVLAVAKGSNF
KVAAQNCYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVAASVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVAADFGQEVADKVRVQYGGSVKPENVASYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagct
aaagcattcgttgaagcagttgcatcaaaacttccttcatcagatcttgttgaagcaggt
atcgctgctccagctcttgatttgacaactgttcttgctgttgcaaaaggctcaaacttt
aaagttgctgctcaaaactgctactttgaaaatgcaggtgctttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgccgt
gactacttccatgaaactgacgaagatatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaatcacttgaaacttacgaagctggtaaagct
gctgaattcgtaggtgctcaagtatctgctgcattggctggattgactgctgaacaagtt
gctgcctcagttatcgcttatgagccaatctgggctatcggtactggtaaatcagcttca
caagacgatgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctgctgactttggt
caagaagtcgcagacaaagttcgtgttcaatacggtggttctgttaaacctgaaaatgtt
gcttcatacatggcttgcccagacgttgacggtgcccttgtaggtggtgcgtcacttgaa
gctgaaagcttcttggctttgcttgactttgtaaaataa

DBGET integrated database retrieval system