KEGG   Streptococcus pneumoniae OXC141: SPNOXC_14540Help
Entry
SPNOXC_14540      CDS       T02074                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SPNOXC_14540 (gpmA)
   01230 Biosynthesis of amino acids
    SPNOXC_14540 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPNOXC_14540 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SPNOXC_14540 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPNOXC_14540 (gpmA)
Enzymes [BR:snx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SPNOXC_14540 (gpmA)
Exosome [BR:snx04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SPNOXC_14540 (gpmA)
  Exosomal proteins of melanoma cells
   SPNOXC_14540 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1475370..1476062)
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPNMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFEFDEKLNVVSEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgattgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gctatcaaaacaactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgcttgaacgaacgtcactacggtggtttgactggtaaaaacaaagctgaa
gctgctgaacaatttggtgatgagcaagttcacatctggcgtcgttcatacgatgtattg
cctccaaacatggaccgtgatgatgagcactcagctcacacagaccgtcgttacgcttca
cttgacgactcagttatcccagatgctgaaaacttgaaagtgactttggaacgtgctctt
ccattctgggaagataaaatcgctccagctcttaaagatggtaaaaacgtattcgtagga
gctcacggtaactcaatccgtgcccttgtaaaacacatcaaaggtttgtcagatgacgag
atcatggacgtggaaatccctaacttcccaccattggtattcgaattcgacgaaaaattg
aacgtcgtttctgaatactaccttggaaaataa

DBGET integrated database retrieval system