KEGG   Streptococcus pneumoniae OXC141: SPNOXC_17250Help
Entry
SPNOXC_17250      CDS       T02074                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 1 (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:snx00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:snx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1754676..1755959)
Genome map
AA seq 427 aa AA seqDB search
MDKIVVQGGDNRLVGSVTIEGAKNAVLPLLAATILASEGKTVLQNVPILSDVFIMNQVVG
GLNAKVDFDEETHLVKVDATGDITEEAPYKYVSKMRASIVVLGPILARVGHAKVSMPGGC
TIGSRPIDLHLKGLEAMGVKISQTAGYIEAKAERLHGAHIYMDFPSVGATQNLMMAATLA
DGVTVIENAAREPEIVDLAILLNEMGAKVKGAGTETITITGVEKLHGTTHNVVQDRIEAG
TFMVAAAMTGGDVLIRDAVWEHNRPLIAKLLEMGVEVIEEDEGIRVRSQLENLKAVHVKT
LPHPGFPTDMQAQFTALMTVAKGESTMVETVFENRFQHLEEMRRMGLHSEIIRDTARIVG
GQPLQGAEVLSTDLRASAALILTGLVAQGETVVGKLVHLDRGYYGFHEKLAQLGAKIQRI
EASDEDE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattgtggttcaaggtggcgataatcgtctggtaggaagcgtgacgatcgag
ggagcaaaaaatgcagtcttacccttgttggcagcgactattctagcaagtgaaggaaag
accgtcttgcagaatgttccgattttgtcggatgtctttattatgaatcaggtagttggt
ggtttgaatgccaaggttgactttgatgaggaaactcatcttgtcaaggtggatgctact
ggcgacatcactgaggaagccccttacaagtatgtcagtaagatgcgcgcctccatcgtt
gtattagggccaatccttgcccgtgtgggtcatgccaaggtatccatgccaggtggttgt
acgattggtagccgtcctattgatcttcatttgaaaggtctggaagctatgggggttaag
attagtcagacagctggttacatcgaagccaaggcagaacgcttgcatggcgctcatatc
tatatggactttccaagtgttggtgcaacgcagaacttgatgatggcagcgactctggct
gatggggtgacagtgattgagaatgctgcgcgtgaacctgagattgttgacttagccatt
ctccttaatgaaatgggagccaaggtcaaaggtgctggtacagagactataaccattact
ggtgttgagaaacttcatggtacgactcacaatgtagtccaagaccgtatcgaagcagga
acctttatggtagctgctgccatgactggtggtgatgtcttgattcgagacgctgtctgg
gagcacaaccgtcccttgattgccaagttacttgaaatgggtgttgaagtaattgaagaa
gacgaaggaattcgtgttcgttctcaactagaaaatctaaaagctgttcatgtgaaaacc
ttgccccacccaggatttccaacagatatgcaggctcaatttacagccttgatgacagtt
gcaaaaggcgaatcaaccatggtggagacagtttttgaaaatcgtttccaacacctagaa
gagatgcgccgcatgggcttgcattctgagattatccgtgatacagctcgtattgttggt
ggacagcctttgcagggagcagaagttctttcaactgaccttcgtgccagtgcggccttg
attttgacaggtttggtagcacagggagaaactgtggtcggtaaattggttcacttggat
agaggttactacggtttccatgagaagttggcgcagctaggtgctaagattcagcggatt
gaggcaagtgatgaagatgaataa

DBGET integrated database retrieval system