KEGG   Streptococcus pneumoniae OXC141: SPNOXC_18450Help
Entry
SPNOXC_18450      CDS       T02074                                 

Gene name
hasC
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
snx  Streptococcus pneumoniae OXC141
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:snx00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPNOXC_18450 (hasC)
   00052 Galactose metabolism
    SPNOXC_18450 (hasC)
   00500 Starch and sucrose metabolism
    SPNOXC_18450 (hasC)
   00520 Amino sugar and nucleotide sugar metabolism
    SPNOXC_18450 (hasC)
Enzymes [BR:snx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SPNOXC_18450 (hasC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1881151..1882050
Genome map
AA seq 299 aa AA seqDB search
MTSKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEDILVVTGK
SKRSIEDHFDSNFELEYNLKEKGKTDLLKLVDETTGMRLHFIRQTHPRGLGDAVLQAKAF
VGNEPFVVMLGDDLMDITDEKAVPLTKQLMNDYEKTHASTIAVMPVPHEDVSSYGVIAPQ
GEGSNGLYSVETFVEKPAPEETPSDLAIIGRYLLTPEIFEILEKQAPGAGNEIQLTDAID
TLNKTQRVFAREFTGARYDVGDKFGFMKTSIDYALKHPQVKDDLKNYLIQLGKELTEKE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaaagttagaaaggcagtcatccctgctgctggactaggaactcgattttta
ccagcaaccaaggcccttgccaaagaaatgttgccaatcgtagacaaaccaactatccag
tttatcgtggaagaagctctcaaatcaggtattgaagatattctagttgtcactggtaaa
tcaaaacgttctattgaggaccactttgattcaaactttgagcttgaatacaatcttaag
gaaaaaggcaaaacggatttgttaaaattggtagatgaaacaactggcatgcgccttcat
ttcatccgccaaactcatccacgcggtctcggagatgctgttttgcaagccaaggctttc
gtcggaaatgaaccttttgtcgttatgcttggtgatgacttgatggatatcacagacgag
aaggccgttcctttgacaaaacaactgatgaatgattacgaaaagacacacgcatcaacc
attgctgtcatgcccgtaccacacgaagacgtttcatcatatggagtcattgctcctcaa
ggcgaaggaagcaatggactctatagcgttgaaactttcgttgaaaaaccagctcccgag
gagactccaagtgatttggcaatcatcggtcgctatctactcacaccagaaatttttgag
attctcgaaaagcaagctcctggtgctggaaatgaaatccaacttactgatgcaatcgat
actcttaataaaacacagcgtgtttttgcccgtgaatttacaggagctcgttacgacgtt
ggggataagtttggctttatgaaaacatctattgactacgccctcaaacatccacaagtc
aaagatgatttgaagaattacctcatccaacttggaaaagaattgactgagaaggaataa

DBGET integrated database retrieval system