KEGG   Sodalis sp. HS1: Sant_0573Help
Entry
Sant_0573         CDS       T03004                                 

Gene name
phoA
Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sod  Sodalis sp. HS1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sod00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sant_0573 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sant_0573 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sant_0573 (phoA)
Enzymes [BR:sod01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sant_0573 (phoA)
Exosome [BR:sod04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sant_0573 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(633909..635348)
Genome map
AA seq 479 aa AA seqDB search
MPHSSGSASLLSLVISAVLLAGAGIAAPAMAADDVLADRSAHGDITQPGGARRLQGDQTA
ALAAALSNRQAKNVILLIGDGMGDSEITAARNYAYGAGKMFPGIDALPITGQYTHYSLDK
TSHKPSYVTDSAASATAWSTGVKTYNGALGVDVRGQDRPTILEMAKAAGKATGNVSTAEL
EDATPAALVAHVSSRKCYGPEKTSELCSAQALENNGRGSIAEQLLAARADVTLGGGGKTF
AEQAKAGQWQGKSLREQALARGYRLVDDAESLNAVTVANQQQPLLGLFAEGNMPVRWQGP
KAVYHGNVDGQPVTCVDNPSRSASVPTLAMMTRKAIDLLKVNPQGFFLQVEGASIDKQDH
AANPCGQFGETVDLDEAVQQALAFARADGNTLVVVTADHAHSSQIIEADAKAPGLTQALI
TKDGAVMAISYGNSEDAESQGHTGTQLRIAAYGPHAANVAGLTDQTDLFYTLRDAMGLK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgccgcattcctctggttcagcttcacttctctctctggtaataagcgccgttcttctt
gccggcgccggtattgccgcgccggcgatggccgcggatgatgtgttggccgatcgctcg
gcccacggcgatatcacccaacccggcggcgcccgccgcctgcaaggcgatcagaccgcc
gcgctggccgccgcgctaagcaaccgccaggctaaaaacgtcattttgcttattggcgac
ggcatgggggattccgaaatcaccgccgcgcgtaattatgcttatggcgcgggaaagatg
tttccgggcatagacgcgctgccaataaccggtcagtacacccattactcattggataag
accagccataaaccgagttatgttaccgattccgccgcatcggccaccgcctggtcgacc
ggcgtcaaaacatacaatggtgcgctgggcgtagacgtgcgcggacaagaccgcccgacg
attctggaaatggccaaagcggcgggtaaagccaccggtaacgtgtccactgccgaactg
gaagatgccacgccggcggcgctggtagcccacgtcagctcgcgcaaatgttatggaccg
gagaagaccagcgagctttgcagcgcccaggcgttggaaaataatggccgcggctcgatt
gcggagcaattgctggcggcgcgggccgacgtcaccctggggggcggcggcaagacattt
gccgagcaggcgaaggccggccagtggcagggaaaaagcctgcgggaacaggccttggcg
cggggttaccggctggtggacgatgctgagagtctgaacgccgtcaccgtcgcgaatcag
cagcaaccgctgctcgggctgtttgccgagggcaacatgccggtacgctggcaggggcct
aaagccgtctatcacggtaatgtcgatgggcagcccgtcacctgtgtcgacaatccgtcc
cgtagcgccagcgtgccgacgctggcgatgatgacccgcaaggccattgatttgttgaaa
gtcaatccgcagggctttttcctgcaggtggagggcgcgtccatcgataaacaggatcat
gccgccaatccttgcggccagttcggcgaaacggtggatttggatgaggcggtacagcag
gcgttggcgtttgcccgcgccgacggcaatacgctggtggtggtgaccgctgaccatgcg
cattccagccagattatcgaggctgacgccaaggcgccgggtttgacacaggcgcttatc
accaaagacggcgcggtaatggccatcagctacggtaattcagaggacgctgaatcgcag
ggccatactggaacccagttgcgcatcgccgcgtacggtccccacgcggccaatgtcgcc
ggcctgactgaccagaccgatctgttttataccctgcgcgatgccatggggttgaagtaa

DBGET integrated database retrieval system