KEGG   Sodalis sp. HS1: Sant_2160Help
Entry
Sant_2160         CDS       T03004                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sod  Sodalis sp. HS1
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sod00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sant_2160
   00650 Butanoate metabolism
    Sant_2160
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sant_2160
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sant_2160
Enzymes [BR:sod01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Sant_2160
Amino acid related enzymes [BR:sod01007]
 Aminotransferase (transaminase)
  Class III
   Sant_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2485312..2486589)
Genome map
AA seq 425 aa AA seqDB search
MSNSELNQRRLAATPRGVGVMCDFFAERAENATLWDSEGREFTDFAAGIAVLNTGHRHPK
VIAAVEQQLARFTHTSYQVVPYASFVTLAEKINAVAPVAGPVKSTFFSTGAEALENAVKI
ARAFTGRPGVITFGGGFHGRTLLTLALTGKVAPYKLGFGPLPGQIFHAQYPNALHDVSVA
QSLASIERLFRTDIAADQVAAILFEPVQGEGGFNIAPPEFLLGLRALCDRHGILMIADEV
QSGFGRTGKLFAMDHCPSVKADIVTMAKSLGGGLPISGVAGRAEVMDAPAPGGLGGTYAG
NPLAVAAALAVLDVIDEEQLCARAARLGDQLQDTLREMKRDCPAIADVRGLGSMVAVEFR
DPVSGEPDAAFAQRIQQQALAQRLLLLTCGVDGNVIRFLYPLTIPETQFNAALALLCTLL
KSPSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatagtgaattgaatcagcgtcgtttggcggccaccccacgcggcgtgggcgtc
atgtgtgatttctttgccgagcgggcggaaaacgccacgctatgggacagcgaagggcga
gaatttaccgatttcgccgccggtattgcggtactgaataccggccatcgccatcccaag
gtcatcgccgccgtagaacaacaattggcgcgctttacccatacctcgtatcaggtggtc
ccttacgccagttttgtcaccctggcggaaaaaatcaatgccgtcgcgccggtggcgggg
ccggtcaaaagtaccttcttcagcaccggggcggaggcgctggaaaatgcggtgaagatc
gcccgcgcctttaccggccggccgggggtgattacctttggcggcggctttcacggccgc
acgctgctgacgctggcgctgaccggcaaagtcgcgccctacaagctgggttttgggccg
ctgccggggcaaatttttcacgcccaatatcccaacgcgctgcacgatgtttcggtggcg
cagtccctcgccagcatcgagcgtctgtttcgtaccgatatcgccgcggatcaggtggcg
gcgattttgtttgagccggtacagggtgagggcggattcaacatcgcgccgccggaattt
ctgctcgggctgcgtgcgttgtgcgatcggcacggtattctgatgattgccgacgaagtg
cagtccggctttggccgcaccggcaaactgttcgccatggaccattgcccgtcggtgaaa
gcggatatcgtgacgatggcgaaaagcctgggcggcggcctgccgatctccggcgtggcc
gggcgcgccgaggtgatggacgcgccggcgcccggcggattgggcggcacctatgccggc
aatcccttggcggtggcggcggcgctggcggtgctggacgtgattgacgaagagcagctt
tgcgcgcgcgcggcgcggttgggtgaccaattgcaggacacgctgcgggagatgaagcgc
gactgtccggccatcgccgacgtgcgcgggctcggctcgatggtggcggtggagtttcgc
gatcccgtcagcggcgagcctgatgccgccttcgcgcagcgtatccagcagcaggcgctg
gcgcagcggctgctgctgctgacctgcggcgtggacggcaacgtgatccgctttttgtat
ccgctgaccattcccgagacgcaattcaatgcggcgctggcgctgttgtgtacgctgctg
aaatcgccttcactttaa

DBGET integrated database retrieval system