KEGG   Streptococcus oligofermentans: I872_00255Help
Entry
I872_00255        CDS       T02649                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
soi  Streptococcus oligofermentans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:soi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    I872_00255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I872_00255
   00620 Pyruvate metabolism
    I872_00255
   00650 Butanoate metabolism
    I872_00255
  Lipid metabolism
   00071 Fatty acid degradation
    I872_00255
  Amino acid metabolism
   00350 Tyrosine metabolism
    I872_00255
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    I872_00255
   00626 Naphthalene degradation
    I872_00255
Enzymes [BR:soi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     I872_00255
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     I872_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
52991..55645
Genome map
AA seq 884 aa AA seqDB search
MADKKKTVEQEDKVLAAEKHVDGLVQKGLLALEEMRKLNQEQVDYIVAKASVAALDAHGI
LAQHAIEETGRGVFEDKATKNLFACEHVVNNMRGVKTAGVIEDDPVTGLTKIAEPVGVVC
GITPTTNPTSTAIFKALIALKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQ
WITEPSMEATAALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYIEKSADLR
QAAHDIVMSKSFDNGMVCASEQAVIIDKEVYDEFVEEFKSYHTYFVNKKEKALLEEFCFG
AKANSKNCAGAKLNADIVGKPATWIAEQAGFKVPEGTNILAAECAEVGPNEPLTREKLSP
VIAVLKAEDREDGLKKARQMVEFNGLGHSAAIHTKDEELAKRFGTEIKAMRIIWNSPSTF
GGIGDVYNAFIPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFE
RNSIQYLQTCEDIERVMIVTDKSIEKLGFVQRVIDQLNARSNRVTIQVFSDVEPDPDITT
VERGAEVMKAFEPDTIIALGGGSPMDAAKVMWFFYEQPEIDFRDLVQKFMDIRKRAFRFP
SLGKKAKYIGIPTTSGTGSEVTPFAVISDKKNNRKYPLADYSLTPTIAIVDPALVESVPD
FIAADTGMDVLTHATEAYTSNFANDYTDGIALQTIKLVFEWLEKSVKTADPEAREKMHNA
STMAGMAFANAFLGMSHSMAHKIGGVHHTVHGRTNAILLPYVIRYNGTRPSKTTTWPKYN
YWKADEKFQDIAKMLGLPHSTPEEAVEAYAKAVYELGVAVGIKMNFKDQGIDEKAWKDSL
HEIALLAYEDQCSPANPRLPMVADMEEIMADAYYGYGERPGRRK
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagaagaaaactgttgaacaagaggacaaagtattagcggctgaaaagcat
gttgacggacttgtacaaaaaggtctcctagctcttgaagaaatgagaaaattgaaccaa
gagcaagtggattatatcgtagcgaaagcttctgttgcagcacttgatgcacacggtatc
cttgctcaacacgcgattgaagaaacaggtcgcggtgtatttgaagacaaggcaacgaaa
aacctttttgcctgtgagcacgtcgtcaacaatatgcgcggtgttaaaactgctggtgtt
atcgaagatgatcctgttactggtttgactaagattgctgagcctgtcggagttgtttgt
ggtatcactccaacgactaacccaacatcaacagcaattttcaaagcattgattgccttg
aagacacgtaacccaatcgtttttgccttccacccatctgctcaagaatcatctgctcac
gcagcgcaaatcgttcgtgatgcagctatcgcagctggagcaccagaaaactgtgtgcaa
tggattacagaaccatctatggaagcaacagcggctttgatgaaccacgatggtattgca
acaatccttgcaaccggtggtaacgccatggttaaggctgcctactcttgcggaaaacca
gctcttggggttggtgccggaaacgttcctgcttacatcgaaaaatctgctgatcttcga
caagcagctcatgatatcgtgatgtctaaatcatttgacaacggtatggtctgcgcatct
gagcaagcggtgatcattgacaaggaagtttatgacgaatttgtagaggaattcaagtca
taccacacttattttgtaaacaaaaaagaaaaagctcttcttgaagaattctgcttcggc
gctaaagcaaacagcaaaaactgtgcgggtgctaagctcaatgcagatattgttggtaag
ccagctacatggattgcagaacaagcaggctttaaagtaccagaaggtacaaacatcttg
gctgcagaatgtgctgaagtaggtccaaatgagccattgactcgcgaaaaactttcacca
gttattgctgtcttgaaagctgaagatagagaagacggtcttaaaaaagctcgccaaatg
gttgaatttaacggacttggtcactcagcagctatccatacaaaagatgaagaattggct
aaacgctttggtactgaaatcaaagctatgcggatcatttggaactctccatctactttc
ggtggtatcggggacgtatataatgccttcattccatccttgacacttggatgtggttca
tacggacgcaactcagttggtgataacgtgagcgctattaaccttctaaacatcaagaaa
gtagggaaacgtagaaataatatgcaatggtttaaagttccttcaaaaatttacttcgaa
cgcaattctatccaataccttcaaacatgtgaagatattgaacgcgttatgatcgttact
gacaaatctatcgaaaaacttggctttgttcaacgtgtgatcgatcaattgaacgcccgt
agcaaccgtgtaacgatccaagtcttctcagatgttgaaccagatccagacatcacaact
gtagaacgtggtgcggaagtgatgaaagcatttgaaccagatacaatcatcgctcttggt
ggtggttctccaatggacgcggcgaaagtaatgtggttcttctacgaacaaccagaaatc
gacttccgtgacttggttcaaaaattcatggatatccgtaaacgtgccttccgcttccca
tcacttggtaagaaagcgaaatacattgggattccaacaacatctggtacaggttcagaa
gtaacaccatttgccgttatctctgacaagaaaaacaaccgcaaatacccattggctgac
tactcattgacaccaactattgcgattgttgaccctgctttggttgaatcagttcctgac
ttcatcgctgctgatacaggtatggacgtcttgactcacgcgactgaggcctacacttca
aacttcgctaatgactatacagacggtattgcgcttcaaactatcaagcttgtctttgaa
tggttggaaaaatctgttaagacagccgatccagaagcacgtgagaaaatgcataatgcg
tctacaatggcaggtatggcctttgcaaatgccttccttggtatgagccactcaatggcc
cacaagatcggtggtgttcaccacactgttcacggacgtacaaatgcaatcttgcttcca
tacgtcatccgttacaatggtactcgtccatctaagacaactacatggcctaagtacaac
tactggaaagctgatgagaaattccaagacatcgcgaaaatgcttggtttgcctcactca
actccagaagaagcagttgaagcatacgctaaagctgtttacgaacttggtgttgcagta
ggtatcaagatgaacttcaaagaccaaggaatcgatgaaaaagcttggaaagatagcttg
catgaaattgctttgcttgcttatgaagaccaatgttcacctgcaaacccacgcttgcca
atggtagctgacatggaagaaatcatggcagatgcttactatggctacggagaacgtcca
ggacgtcgtaaataa

DBGET integrated database retrieval system