KEGG   Streptococcus cristatus: I872_02365Help
Entry
I872_02365        CDS       T02649                                 

Definition
(GenBank) glycogen branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
soi  Streptococcus cristatus
Pathway
soi00500  Starch and sucrose metabolism
soi01100  Metabolic pathways
soi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:soi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I872_02365
Enzymes [BR:soi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     I872_02365
Exosome [BR:soi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I872_02365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AGK70581
UniProt: N0C6C8
Position
490173..492086
Genome map
AA seq 637 aa AA seqDB search
MDKKEALRTFTTGENFHLQHYLGVHQDVVDGKAGYTFRVWAPNAQNVHLIGDFTNWYGDQ
IPMTRNEGGVWEVFTDLPKEGDIYKYNIKRSSGQEILKIDPLAIYFEERPGTGAIVRTIP
EKKWQDGLWLARRKRWGFFSRPVNIYEVHAGSWKRNPDGSPYSMAQLKEELIPYLVEMNY
THVEFMPLMAHPLGLSWGYQLMGYFAFEHTYGTPEEFQDFVEECHLNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHDRAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
VRVDAVSNMLYLDYDSGPWQPNKDGGNRNYEGYYFLQRLNTVIKLFHPDVMMIAEESSSE
TKITGMIEMGGLGFDFKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYSFSENFLLPF
SHDEVVHGKKSMMHKMWGDRYNQFAGLRNLLTYQICHPGKKLLFMGSEFGQFLEWKSEEQ
LEWSNLDDHMNKKMQTFTSELNAFYKDNRPLWEIDLSYDGIEIIDADNTDQSVLSFIRKT
EKGDMLVCVFNMVPVERKNFTIGVPVAAVYEEVWNTELEKWGGVWKEHNETVQSQEGLWK
DYPQTLTFTLPALGASIWKIKRRVNVRKNAKKDSTKE
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaaagaagcattaagaacctttacaacaggtgaaaactttcatttgcagcat
tatttaggagtgcatcaggatgtggtggatggcaaagctggctacacctttagagtctgg
gctccaaatgcgcagaatgtgcatctgattggagattttaccaactggtatggagatcag
attcctatgactcgcaatgaaggcggtgtctgggaagtcttcacggatttacctaaggaa
ggggatatttacaagtacaatatcaaacgcagtagcggtcaggaaatcttgaaaattgat
ccgctggctatctatttcgaagagcgcccaggtacgggagctattgttcggactattcca
gagaagaagtggcaagatggactttggctagctcggagaaagcgttggggctttttctca
agaccggtcaatatctatgaagtgcatgctggatcttggaaacgtaatcctgacggcagt
ccctattctatggctcagcttaaggaggaattgattccttatctggtagaaatgaactat
acacacgttgagttcatgccactcatggcgcatcctttgggactcagctggggctaccag
ctcatgggttattttgcctttgagcatacttatggaacgccagaggaatttcaggatttt
gtcgaggaatgtcacttgaataatattggtgtcattgtggactgggttccaggtcacttt
accatcaatgacgatgccttggcctactatgatggaacaccaacctttgagtaccaggat
catgaccgagctcacaactatggctggggtgccttgaattttgacctaggaaaaaatgaa
gtgcaatccttcttgatttctagcatcaagttctggattgatttctaccatctagatggg
gttcgtgtggatgcggttagcaatatgctctatctagactacgatagtggtccttggcag
ccaaacaaggacggcggtaatcgtaactatgaaggctactatttcttgcaacgtttgaac
acagtcatcaagctatttcatccagatgtcatgatgattgctgaagagagctcgtccgaa
accaagattacgggtatgatagagatgggcggtttgggctttgacttcaagtggaatatg
ggttggatgaacgatattctccgtttctacgaagaagacccgatttaccgcaagtacgat
ttcaatctggtgactttcagcttcatgtattcattttctgaaaatttcctcttgcctttc
tctcacgacgaagtcgttcacggtaagaagagcatgatgcataagatgtggggtgaccgc
tataatcaatttgctggtctacgaaacctcttgacctatcaaatctgccatccaggcaag
aaattgctctttatgggttcagaatttggtcaattcctagagtggaagtcagaagagcag
ttggaatggtcaaatctggacgatcatatgaataagaagatgcaaaccttcacttctgag
ctcaatgccttctataaagacaatcgtccgctttgggagattgatttgagctatgatggc
atcgaaatcattgatgccgacaataccgatcagagcgtcctttcttttatccgtaagacg
gaaaaaggggatatgctagtctgtgtgttcaatatggtgccagtagagcgcaaaaacttt
acaattggtgtgccagtggcagccgtttatgaagaagtatggaatactgaattagagaaa
tggggaggtgtttggaaagaacacaacgaaacagttcagtctcaagagggactatggaaa
gattatccgcagaccttgacctttacgctaccagctttgggagcaagtatttggaaaatc
aagcgtcgtgtgaatgttcgtaaaaatgctaaaaaagattccacaaaggagtag

DBGET integrated database retrieval system