KEGG   Streptococcus oligofermentans: I872_10025Help
Entry
I872_10025        CDS       T02649                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
soi  Streptococcus oligofermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:soi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    I872_10025
Enzymes [BR:soi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     I872_10025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2026760..2028292)
Genome map
AA seq 510 aa AA seqDB search
MKARQSGVLMHISSLPGKYGIGSFGQSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDLDFLIDEGLLAEEDLKGVDFGDDPKAVDYAKVFEARRPLLEKAVARFL
KVGDLDKFRHFVAENAAWLELFAEYMAVKEHFDLKAWTEWPDEAIRRRQPESLASYREQL
ADKLEYHRVTQYFFFKQWLQLKKYANDHHIEIVGDMPIYVAADSADVWAQPHFFKTDEQG
RPVKVAGCPPDEFSETGQLWGNPIYNWEAMDQDGYAWWIERLRESFKIYDIVRIDHFRGF
ESYWEVPAESETAATGHWVKGPDYKLFAAVKEALGDLNIIAEDLGFMTDEVIELRERTGF
PGMKILQFAFNPDDESIDSPHLAPHNSVMYTGTHDNNTVLGWYKDEIDDPTREYMAQYTN
RKEYETVPHAMLRTAFASVSYMAIATMQDLLELDGSARMNLPSTIGGNWAWRMTAEELNS
AVEEQLYYLTKIYRRLNTDLLPQENKRNTF
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgagacaaagtggtgtattgatgcacatttcctctttgccaggcaagtacggg
attggttcttttggtcagtctgcctatgattttgtggatttcttagttagaacgaagcaa
cgttattggcaaatcttgcctttgggaacgactagctatggggactctccttaccagtct
ttctcagcctttgcagggaatactcactttattgatttggatttcttgattgacgaaggc
ctgttggcagaagaagatctaaaaggcgttgattttggtgatgatccaaaagctgtagat
tatgcaaaagtatttgaagcacgtcgtcctcttttggaaaaagcggttgctcgtttcctt
aaagttggcgatcttgacaaattccgtcactttgttgcggaaaatgcagcttggttggag
ctttttgcggaatacatggctgttaaagagcattttgatctgaaagcttggacagaatgg
ccagatgaagcgattcgtcgtcgccaaccagaaagcttggctagctaccgtgagcaattg
gcggacaagttggaataccatcgtgtaacccaatatttcttctttaaacaatggttgcaa
cttaagaaatatgccaacgatcatcatatcgaaatcgttggtgatatgccaatctatgtg
gctgctgacagtgcggatgtctgggctcaacctcatttcttcaagacagacgagcaaggc
cgtccagtcaaggttgctggttgcccgccagatgaattctcagagactggtcagttgtgg
ggtaacccaatttataattgggaagctatggatcaagatggctatgcttggtggattgag
cgcctgcgcgaaagcttcaagatttacgacatcgttcggattgaccacttccgtggcttt
gagtcttattgggaagtgccagcggagtctgaaacagcggctactggtcactgggtcaaa
ggtccagattataaacttttcgctgcggtcaaagaagctttgggtgatttgaacatcatt
gcagaagatcttggcttcatgacagatgaagtaattgaattgcgtgagcggactggcttc
ccaggtatgaagattcttcaattcgctttcaacccagatgatgaaagcattgatagtcca
cacttggcgccacataattctgtgatgtacactggtactcacgacaataacaccgtactg
ggctggtacaaggatgagatcgatgatccaactcgtgaatacatggctcaatacaccaac
cgcaaagaatacgaaacagtgccacacgcaatgcttcgtacagcctttgcttctgttagc
tacatggctatcgcaacgatgcaggacttgctggagttggatggctctgcccgtatgaac
ctgccatctacgattggcggcaactgggcatggcggatgacagctgaagagctaaattct
gctgtggaagagcagctttattacctgacgaaaatctatcgtcgtttaaatactgactta
cttccacaagaaaataaaagaaatactttctaa

DBGET integrated database retrieval system