KEGG   Sulfolobus solfataricus 98/2: Ssol_0293Help
Entry
Ssol_0293         CDS       T02126                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00020  Citrate cycle (TCA cycle)
sol00640  Propanoate metabolism
sol00660  C5-Branched dibasic acid metabolism
sol00720  Carbon fixation pathways in prokaryotes
sol01100  Metabolic pathways
sol01110  Biosynthesis of secondary metabolites
sol01120  Microbial metabolism in diverse environments
sol01130  Biosynthesis of antibiotics
sol01200  Carbon metabolism
Module
sol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sol_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ssol_0293
   00640 Propanoate metabolism
    Ssol_0293
   00660 C5-Branched dibasic acid metabolism
    Ssol_0293
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_0293
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ssol_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ACX90587
UniProt: D0KN52
Position
252869..253882
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGIVTTEPIKWGGKAVVKSQLLEGARGKRGLVRVTDDVYN
TILELKKLGVEKFLVEEFVPHEKEFYASVLLDRESAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIIEAEKYLGVKGLGQIIQGLYKLFVEYDAELVEINPLALTSDGRLLALD
SKVILEDNALFRHEDLLKELGRQEIHDSYVELDGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGASREHVKESVLKVGSNPKVKKVVINIYGGITRCDEVALGIVDALKEIKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacgaatacgagggaaagagtctttttaaacgagtaggaattccagtgcct
aatggtatcgtaactacagaaccgataaaatggggaggaaaggctgtagtgaaatctcaa
cttttggaaggtgcaagaggcaagagaggactagtaagagtaactgacgatgtttataat
accattttagagttgaaaaaactaggagtagagaaattcttagtggaggagttcgttcct
cacgagaaggagttttacgcttcagtattattagatagggaatctgcagaaccaatgctg
gttttatccagagaaggaggtattgatgttgagcaagctaaggacgttaagaagatgata
ataccattagaaaggggagttaggagttatgatattattgaggctgagaagtatctagga
gttaagggattagggcaaataatacaaggtttatataaattatttgtagaatatgacgct
gaactagttgaaataaacccattagcattgactagtgatggcagattattggcattggac
tctaaggtgattttagaggacaacgcgttatttagacatgaggatttgttaaaggaatta
ggaaggcaagaaattcatgatagttatgtggaactagatggagatataggaataataggt
aatggagctggattaaccatggcttcaatggatttagttaaattaaatggtgggaatcca
gctaatttcttggatgtcggtggaggagcaagtagggaacacgttaaggaaagcgtactc
aaagtaggtagtaatcctaaagttaagaaagttgttataaatatttacggcgggattacc
agatgtgatgaggtagcgttaggtatagttgatgcattaaaggagataaagaagccaata
tttgttagattgctaggtacaaatgaggagttagggaagaaaatattaagagagaacgga
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system