KEGG   Sulfolobus solfataricus 98/2: Ssol_0293Help
Entry
Ssol_0293         CDS       T02126                                 

Definition
(GenBank) Succinate--CoA ligase (ADP-forming) (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_0293
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ssol_0293
   00640 Propanoate metabolism
    Ssol_0293
   00660 C5-Branched dibasic acid metabolism
    Ssol_0293
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_0293
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ssol_0293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
252869..253882
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKSLFKRVGIPVPNGIVTTEPIKWGGKAVVKSQLLEGARGKRGLVRVTDDVYN
TILELKKLGVEKFLVEEFVPHEKEFYASVLLDRESAEPMLVLSREGGIDVEQAKDVKKMI
IPLERGVRSYDIIEAEKYLGVKGLGQIIQGLYKLFVEYDAELVEINPLALTSDGRLLALD
SKVILEDNALFRHEDLLKELGRQEIHDSYVELDGDIGIIGNGAGLTMASMDLVKLNGGNP
ANFLDVGGGASREHVKESVLKVGSNPKVKKVVINIYGGITRCDEVALGIVDALKEIKKPI
FVRLLGTNEELGKKILRENGVNVYDDVLKMIGDAVRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacgaatacgagggaaagagtctttttaaacgagtaggaattccagtgcct
aatggtatcgtaactacagaaccgataaaatggggaggaaaggctgtagtgaaatctcaa
cttttggaaggtgcaagaggcaagagaggactagtaagagtaactgacgatgtttataat
accattttagagttgaaaaaactaggagtagagaaattcttagtggaggagttcgttcct
cacgagaaggagttttacgcttcagtattattagatagggaatctgcagaaccaatgctg
gttttatccagagaaggaggtattgatgttgagcaagctaaggacgttaagaagatgata
ataccattagaaaggggagttaggagttatgatattattgaggctgagaagtatctagga
gttaagggattagggcaaataatacaaggtttatataaattatttgtagaatatgacgct
gaactagttgaaataaacccattagcattgactagtgatggcagattattggcattggac
tctaaggtgattttagaggacaacgcgttatttagacatgaggatttgttaaaggaatta
ggaaggcaagaaattcatgatagttatgtggaactagatggagatataggaataataggt
aatggagctggattaaccatggcttcaatggatttagttaaattaaatggtgggaatcca
gctaatttcttggatgtcggtggaggagcaagtagggaacacgttaaggaaagcgtactc
aaagtaggtagtaatcctaaagttaagaaagttgttataaatatttacggcgggattacc
agatgtgatgaggtagcgttaggtatagttgatgcattaaaggagataaagaagccaata
tttgttagattgctaggtacaaatgaggagttagggaagaaaatattaagagagaacgga
gtaaacgtatatgatgatgtattaaaaatgataggtgatgcagtacgctcataa

DBGET integrated database retrieval system