KEGG   Sulfolobus solfataricus 98/2: Ssol_0342Help
Entry
Ssol_0342         CDS       T02126                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ssol_0342
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_0342
  Lipid metabolism
   00071 Fatty acid degradation
    Ssol_0342
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ssol_0342
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ssol_0342
   00626 Naphthalene degradation
    Ssol_0342
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ssol_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
301437..302480
Genome map
AA seq 347 aa AA seqDB search
MRAVRLVEIGKPLSLQEIGVPKPKGPQVLIKVEAAGVCHSDVHMRQGRFGNLRIVEDLGV
KLPVTLGHEIAGKIEEVGDEVVGYSKGDLVAVNPWQGEGNCYYCRIGEEHLCDSPRWLGI
NFDGAYAEYVIVPHYKYMYKLRRLNAVEAAPLTCSGITTYRAVRKASLDPTKTLLVVGAG
GGLGTMAVQIAKAVSGATIIGVDVREEAVEAAKRAGADYVINASMQDPLAEIRRITESKG
VDAVIDLNNSEKTLSVYPKALAKQGKYVMVGLFGADLHYHAPLITLSEIQFVGSLVGNQS
DFLGIMRLAEAGKVKPMITKTMKLEEANEAIDNLENFKAIGRQVLIP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagttagattagtagaaataggaaaaccccttagcttacaagagataggtgtg
cctaaacccaaaggacctcaagtcttaataaaagtagaggcagcgggagtttgtcattct
gatgtgcacatgagacaaggaaggtttgggaatttaagaatagtggaggatttgggtgta
aaattgcccgtaactttaggtcatgagattgcaggaaaaatagaggaagttggagatgaa
gtagttggatattctaagggggatctagttgcagttaatccttggcagggagaaggaaat
tgctactattgtagaataggagaggagcatctgtgtgactctcctagatggttggggatt
aattttgatggagcttatgcagagtatgtaatagttcctcattataaatatatgtataag
ctgagaagacttaacgctgtagaagcagcaccgttaacttgttctggaataactacatat
agggcagtaagaaaggcatctttagatccaactaagacactactagtagtgggtgctgga
ggaggcttaggcacaatggcagtgcagatagccaaagctgttagtggtgcaacgataata
ggtgtggatgtgagggaagaggcagtggaggctgctaagagagctggagctgactacgta
ataaacgcatcaatgcaagaccccttagcggagataagaaggataactgaaagtaaggga
gtggatgccgtaatagacctgaataactctgagaaaacgctttcagtttaccctaaagct
ttggcaaaacaaggtaaatacgtaatggtgggattgtttggtgcagatttgcattatcat
gcacctctaataactttatcagaaatacaatttgtaggcagtttagttgggaatcaatca
gacttcttggggataatgagattagcagaggctggtaaagtcaaacctatgataactaaa
actatgaaactagaagaggcaaatgaggctattgataatttagagaattttaaggctatt
ggaagacaagtactcataccataa

DBGET integrated database retrieval system