KEGG   Sulfolobus solfataricus 98/2: Ssol_0401Help
Entry
Ssol_0401         CDS       T02126                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_0401
   01230 Biosynthesis of amino acids
    Ssol_0401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_0401
   00051 Fructose and mannose metabolism
    Ssol_0401
   00562 Inositol phosphate metabolism
    Ssol_0401
Enzymes [BR:sol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ssol_0401
Exosome [BR:sol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ssol_0401
  Exosomal proteins of bladder cancer cells
   Ssol_0401
  Exosomal proteins of melanoma cells
   Ssol_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360578..361261
Genome map
AA seq 227 aa AA seqDB search
MKPPIIIINFKAYENSFGDKAVNLGKKIEKISKEYSVEIILSTPATMIYRMSQEVDLPIY
AEHVDPVPLGAFTGAILPEMVKDAGAKGTLINHSERRLRADEIDDVLKRTKKLGLKSILC
VDRYELVYPFSLLKPDAILIEPPELIGTGVSVSKAKPEVITRAVDEIRKSEGIYLIAGAG
ITTGEDVYKALKLGAHGIGVASAVMKAKEPEKVVEDFITSALRAISS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacctcctattattataataaactttaaggcatacgagaactcgtttggtgataaa
gcagtaaatttaggtaaaaaaatagaaaaaataagtaaagagtactcagttgaaatcata
ttgtcaacaccagccaccatgatatatagaatgtctcaggaagtagatttaccaatttat
gctgaacatgtagacccagtacctttaggagcatttactggagcgatattaccagaaatg
gtaaaagatgcaggtgctaagggtactttaataaatcacagtgagagacgtctaagagct
gatgaaatagatgatgtgctaaaaaggaccaaaaaattaggtttaaagagtatattatgt
gttgacagatatgaattggtatatccctttagtttgctgaaacctgacgcaattttaata
gagcccccagaattgataggaactggtgtctcagtttcgaaggctaaacctgaggtaata
actagagctgtagatgagataagaaagtccgagggaatatatctaatagcaggggctgga
attactactggtgaggatgtttataaggcgttgaagcttggagctcatggaataggtgta
gcaagtgctgttatgaaggctaaagagcctgaaaaggttgttgaggactttattacaagt
gcattgagggcgatctcttcgtag

DBGET integrated database retrieval system