KEGG   Sulfolobus solfataricus 98/2: Ssol_0543Help
Entry
Ssol_0543         CDS       T02126                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sol00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(491214..492131)
Genome map
AA seq 305 aa AA seqDB search
MRQLDALKSPRFTQISTFGRLPICEKNEEIKAAFLGIPFDDAVTYRPGARFGPMGIRQGS
RLLRPYNQFLDTYPFDKLNACDMGDINVIPGYIEDTMNAIQTSLYEIISSKNLVPFIAGG
DHSITLPILRTLYKKFGKINIVHFDSHYDFWDSYWGKKYTHGTWLRRAIEEGLIKEAVQG
GIRASTFSKEDLRDKERLGIRSFTIRDLKYNLDTVIREINSLSGPTHVSIDIDVVDPAFA
PGTGTPEVGGLTSFEIIEIVRKLRFDKLVGFDVVEVAPPYDMSEITAMLAANIIYEGMSV
LSLNL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagacaattagacgcgttaaaatctccacgtttcacacaaatttctacctttggtagg
ttaccaatttgtgaaaaaaatgaggagataaaggctgcatttttaggaataccttttgat
gacgctgtaacttacagacctggagccagatttggacctatgggaataaggcaaggatct
agattgttaagaccctataatcaattcttagatacttatccttttgataagcttaacgct
tgtgatatgggagatataaatgttattccagggtatattgaagacacaatgaacgcaata
caaactagcctctacgaaataatatcatcgaaaaatctagtaccttttattgctggtgga
gatcattcgattacgttacccattttaaggaccttatataaaaagtttgggaaaataaat
atcgtacactttgattctcattacgatttctgggattcctattggggaaagaaatataca
catggcacgtggttgaggagagcaatcgaggaaggcctaattaaagaagcggtacaagga
gggattagagcctcaactttctcaaaggaagatctgagggataaggaaagattgggaatt
aggagctttacaattagagatttaaagtataatttagacactgtaattagagagataaat
tccctatctggtccaacacacgtctcaattgatatagatgttgtagatccggcatttgct
cccgggactggtacacctgaagttggaggcctcaccagttttgaaattattgaaatagtt
agaaagttaagatttgataagctagttggatttgatgttgtagaggttgcgccaccatat
gatatgagcgaaattacagcaatgttggccgcaaatatcatctatgaaggaatgagcgta
ctttcattaaatctttaa

DBGET integrated database retrieval system