KEGG   Sulfolobus solfataricus 98/2: Ssol_0569Help
Entry
Ssol_0569         CDS       T02126                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_0569
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_0569
   00020 Citrate cycle (TCA cycle)
    Ssol_0569
   00620 Pyruvate metabolism
    Ssol_0569
   00640 Propanoate metabolism
    Ssol_0569
   00650 Butanoate metabolism
    Ssol_0569
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_0569
   00680 Methane metabolism
    Ssol_0569
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ssol_0569
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ssol_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(517244..518446)
Genome map
AA seq 400 aa AA seqDB search
MIRKIISGNEAVALGVKLARVGVTGIYPITPQTTIIEKLAEMRAKGEIETEIVRVESEHS
AMAATFGAALGGVRAFTATASQGLLYMHEMVWWVAGSRVPVVMVVGTRAVGAPWNIWNEH
TDFTSERDSGWIMAFASNPQEALDLTLQAFRISEDERVFLPMMIGMDGFILSHTKTNVLI
PDQDQVDDFLPPRRQPYVIDPEDPVGMGNIFPPEGYMRLRESIDLALRNSEDVIKEIGRE
YNKKINPLGDYSTLNVSYKLEDADYAVVLMGAWAGDAMEAVDTLREKGIKIGMLRIRYLR
PWSEKEIRNTLKDKKAVLVLDRSTSFGRGGGPLYVEIKSTISNVVPQIKGVVSGLGGVTV
NKNDLVYIFNKFVEGLKDDVIWYYPKEVGKIELRTPRDIE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaaaattatttccggaaatgaggctgtagccttaggcgtaaaactagcgaga
gtaggagttactggaatatacccaataacaccacaaaccacaataattgagaaattggca
gagatgagagctaaaggtgaaattgaaaccgaaatagtgagagtcgagagtgaacattct
gcaatggctgcaacgtttggtgctgccttaggcggtgttagggcctttactgctaccgca
tcccagggtctactttacatgcacgaaatggtgtggtgggttgctgggagtagagtacca
gtagtgatggttgtaggtactagagccgtaggagctccatggaacatatggaatgagcac
acggactttacgagcgagagagatagtggatggataatggcatttgcgagtaatccacaa
gaagcattagatctgactttacaagcatttaggatctcagaagacgaaagagtgttccta
ccaatgatgatcggtatggatggatttatcctttcacatactaagactaatgtgctaata
cccgatcaggatcaagttgatgacttcttacctccaagaaggcaaccgtatgtgatagat
ccagaagatccggtaggtatgggtaatatatttcctcctgagggctatatgagattaagg
gaatcaatagatctagcgctgagaaactcagaggatgtaataaaggaaataggaagagaa
tacaataagaagattaatccactgggagattattccactctaaacgtatcgtataaacta
gaagatgctgattacgcagtagttttaatgggagcatgggcaggagatgcaatggaggct
gtggacacattaagggagaagggaataaaaataggtatgttaagaataaggtatcttaga
ccttggagtgagaaagagataagaaatacattaaaggataaaaaggcggtcctagtgtta
gataggagtacgagctttggcagaggtggaggtccgctttatgttgaaataaagtctaca
atctcgaatgttgtaccacaaataaaaggtgtagtaagtggattgggtggtgttacagtt
aacaaaaacgatctcgtatatatatttaacaagtttgtagaaggcctaaaggatgacgta
atttggtattatccaaaggaggtagggaaaattgagcttaggactccgagagatattgaa
taa

DBGET integrated database retrieval system