KEGG   Sulfolobus solfataricus 98/2: Ssol_0665Help
Entry
Ssol_0665         CDS       T02126                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_0665
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_0665
   00620 Pyruvate metabolism
    Ssol_0665
   00640 Propanoate metabolism
    Ssol_0665
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_0665
   00680 Methane metabolism
    Ssol_0665
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ssol_0665
Lipid biosynthesis proteins [BR:sol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ssol_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(614399..616399)
Genome map
AA seq 666 aa AA seqDB search
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTL
DDSNPPFYKWFVGGELNASYLTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYD
LYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLAAARIGVVFTVVFSGFSADAL
ASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGI
TILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPINPEAWEWLWKLVGREEVPFGS
TWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGT
YELESALIEHPAVAEAAVIGVPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGP
IATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITTLEDEASVEEIKKALEEFKAE
FEKINK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaacgtgggctctaccttttgatcaaaagataaacccaaaactgaatttaaat
aggctagtaagtataactacgtataaagagattcacagccaaacggtaaaagattacaaa
caattttgggcatctgtagcctcggaaattgactggttcaaaccatgggagaaaacacta
gacgatagtaatcctccattctataagtggttcgtaggtggagagcttaacgcctcttat
ctaactgtagataggcacgttaagagctggaggaagaataaggttgccataatatgggaa
ggagaaccagtggacgagaagggaaacccaaaggaggttaggaagttaacatattacgat
ctatatagggaagttaatagagtagcctatctcttgaaggagaaatacgggttaaagaaa
ggtgatgcaatagcgatttaccttccaatgataccggaattaccaatattcatgttagct
gctgctaggatcggagtagtctttacggtggtgttctcaggatttagcgctgacgcattg
gcaagtaggattaatgacgccgaagccaagttactaattaccgcagatggtggatggaga
aggggtaaagttgttgacttaaagggaattgtagataaggctttggagaagaccccaaca
ataaaggatgtaatagtagttagaaggataggtaataaggtcaacatggttgaaggtagg
gataagtactttgatgaagtaatcaaggacattccacaaaatgtttacgttgaaccagaa
aggatgaaatctgaagacccgttatatatactctacacctctggaaccactggaaaacct
aagggtatagtccacgatattggagggtatatgacattattacacgctacaatgaagtgg
gtattcgatataagggatgacgacatttactggtgtaccgcagatataggatgggttact
ggacactcttacattgtgtttggaccattaatggaaggagcaactgaaataatgtatgaa
ggagccttggattatccacaaccggataggtgggtatcgataattgaaaggtatgggatc
acaatcctttatacctcacccactgcaattagaagcttcatgaaatatggtgataattgg
gttaaggctcacattacctccactgttaggctaatgcattctgtaggtgaaccaataaat
ccggaagcttgggagtggctatggaaattagtcggtagagaggaggtaccatttggaagc
acttggtggatgactgagactggaggtattctaatatctcatttaccaggattgtatctt
gtgccaatgaaacctgggacaaatggcccaccaatattgggaattgagccagatgtagtt
aatgaagatgggaaacaagttaaccttgaggaaagaggatatcttgttataaagaatccg
tggcctggaatgccattaacaatttacaaggatcctgaaagatacgtgaaggtgtattgg
agtagattccctggaatgttctatgttggtgattacgctgttaaggacaaggatggatac
ttctggatattagggagggctgatgaagttatcaaggtagctgggcataggctaggtaca
tatgagttagaatcagctttaattgagcatcctgcagttgcggaagcagcggtaattgga
gtcccagacccagttaagggagaggtgccttatgcgtttgtaattttgaggcaaggttat
acacctaatacgcagctttcacaagagatactgaagacggtaagagataaggtgggacct
atagctactatagataagatattcttcgtgggtaagttgcctaaaacgagaagtggaaag
ataatgagaagagttgtaagggctgttgcaactagggcagaagtgggagatataactaca
ttagaggatgaggcttctgtagaggagattaaaaaagctttagaggagtttaaggcagag
tttgaaaagatcaacaaataa

DBGET integrated database retrieval system