KEGG   Sulfolobus solfataricus 98/2: Ssol_1263Help
Entry
Ssol_1263         CDS       T02126                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_1263
   01230 Biosynthesis of amino acids
    Ssol_1263
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_1263
   00030 Pentose phosphate pathway
    Ssol_1263
   00051 Fructose and mannose metabolism
    Ssol_1263
  Energy metabolism
   00680 Methane metabolism
    Ssol_1263
Enzymes [BR:sol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ssol_1263
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ssol_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1170848..1171996)
Genome map
AA seq 382 aa AA seqDB search
MKTTLSVIKADIGSLAGHHVVHPDTIAAANKILAEAKRNNIISDYYITYVGDDLQLIMTH
NRGELDTRVHETAWNAFKEAAKIAKDLGLYAAGQDLLSDSFSGNLRGMGPGIAEIEFEER
PAEPVVIFMADKTEPGAYNLPLYKIFADPFNTAGLVIDPTMHEGYKFEVLDVYEGESIML
NTPEESYDLLALIGTPSRYIVRRVYRKADNLQASVVSVERLNLIAGKYVGKDDPVMVVRA
QHGLPALGEILEAFTVPYLVPGWMRGSHYGPLMPVSQKDARATRFDGPPRLISLGFNIKN
GKLVGPTDLFDDPAFDEVRRTAVIIADYIRKHGPFMPHRLEPQEMEYTTLPLVIEKLKNR
FKKETDMYKTKPSVYSHESSHE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactacacttagtgtaatcaaggccgatataggaagcctagctggacatcatgtt
gttcaccctgatactatagctgcagctaacaaaatattggccgaagctaaaaggaataac
ataatttccgattactacataacctatgttggtgatgatttacaattaataatgacacat
aacagaggagaactggatactagagttcatgaaacagcttggaacgcatttaaagaagct
gcaaaaatagctaaggatctaggattatatgctgcaggacaagatttactttcggattct
ttttctggtaatcttagaggtatgggccctggaatcgctgaaatagaatttgaagaaaga
cccgctgaaccagtagttattttcatggctgataaaactgagcctggtgcatataatctt
ccattatataagatatttgcagatccatttaatactgccggactggtaatagatccaact
atgcatgaagggtataaatttgaagttttagatgtatatgaaggagagtcaataatgctg
aacacaccagaggagagttatgatttgcttgcgctaataggaacacctagtagatatata
gtgcgaagagtttataggaaagccgataatttgcaagcatcagttgtctccgtagaaaga
ttgaatctaatagctggaaaatacgtaggtaaagacgatccagttatggtagtaagggct
caacacggtctgcctgcgctaggagaaattttagaagcgtttacagtaccttatttagta
ccagggtggatgagaggcagtcactatggacctcttatgccagtatctcaaaaggatgcg
agggctacaagattcgatggcccacctaggctaataagtttaggatttaacattaaaaat
ggaaaactggtaggtccaactgatttattcgatgatcctgcatttgatgaagttagaaga
acggctgtaataattgcagattacattaggaaacatggcccgtttatgccccatagatta
gagccacaagaaatggagtatactactctaccattagtgatagagaagttaaagaataga
tttaagaaagagacagatatgtataaaactaaaccaagcgtatattcacacgaaagttca
catgaataa

DBGET integrated database retrieval system