KEGG   Sulfolobus solfataricus 98/2: Ssol_1421Help
Entry
Ssol_1421         CDS       T02126                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sol00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314059..1314952
Genome map
AA seq 297 aa AA seqDB search
MSDGRLLYLNENSRKFAGFNKEKSPFVIIGIPMDITSSYRPGSRFAPSSIRESAQYIEFY
SIRNDVDMGEIGFNDVGDIILHPSNVEENLSRISSVISYFQESGKITISIGGEHTITAGI
IKGTKREGLCLVSFDAHLDLRDEYMGYRYDHACVMRRISEYGVKIIEVGTRAVSKEEIEY
AKQKGILFFTPQQIRLLGVKETARRIITSTQECKSLYISVDMDGIDPAYAPGVATPEPDG
LDPTNLLDIINLIADKRVIGFDIVEVSPSYDTSGITSVLASRIILETAATVYKARSL
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatggaagattactttatttaaatgagaatagtaggaaatttgctggatttaac
aaggaaaaatccccatttgtaataattggaatacctatggacattacgagtagttatagg
cctggaagtagatttgctccgtcttcaattagagaatcggctcaatatattgaattttat
tcaatacgaaatgatgtagatatgggggaaataggtttcaatgatgtaggtgatataatt
ctacatccttcaaacgttgaggagaatttaagtagaatatccagtgtgattagttatttc
caagaaagtgggaagatcactatttctataggaggagagcatacaataaccgcgggaata
ataaaggggactaagagagaaggattatgcctagttagcttcgatgcacatttagattta
agagacgagtatatgggatatagatatgatcacgcttgtgttatgaggagaatatctgaa
tatggtgtgaaaattattgaagtcggtactagggcagttagtaaagaggaaatagaatat
gctaaacaaaagggtatactcttcttcacccctcagcaaattagacttttaggagtcaag
gaaactgcaagaagaataattacctcaacgcaagaatgtaaatcgctctatatctcagtt
gatatggatgggatagatccagcttatgcacccggcgtagcaacaccagaaccagatgga
ttagaccccactaacctgttagatattattaacttaattgcagataaaagagttataggg
tttgatattgtggaagtttctccttcttatgacacctcaggaataactagtgtattggct
tccagaataattctggagacagcagctacagtttataaagctagatcgctttaa

DBGET integrated database retrieval system