KEGG   Sulfolobus solfataricus 98/2: Ssol_1460Help
Entry
Ssol_1460         CDS       T02126                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sol  Sulfolobus solfataricus 98/2
Brite
Enzymes [BR:sol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ssol_1460
Transfer RNA biogenesis [BR:sol03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Ssol_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1344455..1345876)
Genome map
AA seq 473 aa AA seqDB search
MQVIRKPTRMLSGVTIVSIMTHPHSCQHGKCIFCPGGADIGTPQSYYGREPTLMRAIENN
YDPFYQVQSRLRQYVENGHTPSKVELIIMGGTFLSLPMDYQDWFVTYALEAMNRFPNSNK
PPFVYLEDAQLNNEKADIRCVGMTIETKPDWAKEWHADQMLRLGATKVELGVQTVYDDIL
KFTNRGHTVKDSIESTRILKDSGFKVVYHIMLGLPKSDPDKDLEAFKTIFSDPNFRPDML
KIYPTLVVETAPLVNLWKRGLYRPYDTETLVDLISEMYKYIPKWVRVMRIQRDIPANVIL
DGNKKGNLRELVEKRVLEKGMKIKEIRFREVGMMWQHRGLLPDDSKIHLYKEIYEASEGT
EIFLSFEDNKEILIGYLRLRIPSNKAHRKEIDGKTAIVRELHVYGIEVPIGSWDELGFQH
KGYGSKLLSEAERIAREEFDMKKISVLSGIGAREYYAKKGYIKEGPYMSKKLI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaataaggaaaccgactaggatgctttctggcgttacaatagtatctatcatg
actcatccacactcttgccagcatgggaagtgtatcttctgccctggaggagcagatata
ggcactcctcaaagttattatggaagggaaccaactttaatgagagcaatagaaaacaat
tacgatccattttatcaagtacagtctagattaagacaatatgttgagaatggacataca
ccaagcaaagtagagctaataattatgggtggtacttttctatcacttcccatggattat
caagattggttcgtgacctatgccttagaagctatgaacagatttcctaactccaataaa
cctccctttgtgtatttagaagacgcgcagttaaataacgaaaaagcggatatacgatgc
gtaggaatgacaattgaaacaaaacccgattgggctaaggaatggcatgcagatcaaatg
ctaagattaggtgcgactaaagttgaattaggagtacaaactgtatacgatgacatttta
aagttcaccaataggggtcatactgtaaaagactccatagaatctactagaatactaaag
gactcgggattcaaagtggtttatcatatcatgcttggcctccctaaatcggaccccgat
aaagatctggaggcgttcaagacgatattttcagaccctaattttaggccggatatgtta
aaaatatatcctaccttagtagttgaaacagcaccattagtaaatttgtggaaaagagga
ttgtatagaccttacgatacggaaactttagttgacttaatatctgaaatgtacaagtat
attcctaaatgggttagagtaatgagaatacaaagagacatccccgcaaatgtaatctta
gacggtaataaaaaggggaatttgagagaactagtagagaagagagttctagaaaaggga
atgaagattaaagagattaggtttagggaagtcggaatgatgtggcaacacagaggatta
ttaccagatgatagcaaaattcacctttacaaggaaatttatgaggcaagtgaaggtact
gaaatttttctatcttttgaagacaataaagagatcttaataggttatttacgattaaga
attccgtcaaataaagctcacaggaaagagatagatggaaagactgcgatagtgagggaa
cttcatgtatatggaatagaagtacccataggtagctgggatgaactgggcttccaacat
aagggttacggaagtaagttgctaagcgaagctgaaagaattgcgagagaggagtttgac
atgaagaaaatttcggttttatctggtataggtgctcgggaatactatgctaaaaaaggc
tatataaaagaaggtccttatatgtctaagaagttgatttaa

DBGET integrated database retrieval system