KEGG   Sulfolobus solfataricus 98/2: Ssol_1613Help
Entry
Ssol_1613         CDS       T02126                                 

Definition
glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.59)
Orthology
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_1613
   01230 Biosynthesis of amino acids
    Ssol_1613
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_1613
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Ssol_1613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1451065..1452087)
Genome map
AA seq 340 aa AA seqDB search
MINVAVNGYGTIGKRVADAIIKQPDMKLVGVAKTSPNYEAFIAHRRGIRIYVPQQSIKKF
EESGIPVAGTVEDLIKTSDIVVDTTPNGVGAQYKPIYLQLQRNAIFQGGEKAEVADISFS
ALCNYNEALGKKYIRVVSCNTTALLRTICTVNKVSKVEKVRATIVRRAADQKEVKKGPIN
SLVPDPATVPSHHAKDVNSVIRNLDIATMAVIAPTTLMHMHFINITLKDKVEKKDILSVL
ENTPRIVLISSKYDAEATAELVEVARDLKRDRNDIPEVMIFSDSIYVKDDEVMLMYAVHQ
ESIVVPENIDAIRASMKLMSAEDSMRITNESLGILKGYLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatgtagctgttaacggttatggtactatagggaaaagagtcgctgatgccatc
attaaacaaccagacatgaaattagtaggggttgcgaagacatctccaaattacgaagct
tttatagcacaccgtaggggaatcagaatttacgtaccccaacagtccattaagaaattc
gaagagtcgggaataccagtggctggcacagtagaggatctaataaaaacctcagatatt
gtagtggatactacgccaaatggtgttggtgcacaatataagccaatttatctacaatta
cagagaaacgctatatttcaaggtggcgaaaaagctgaagtagctgatatctcattctca
gccttatgtaattataacgaggcccttggcaaaaagtacattagagtagtatcatgtaat
actactgcactacttagaacaatatgtacagtaaataaggtcagtaaagtggagaaagtt
agagcgacaatagttagaagagctgctgatcaaaaggaagtcaagaagggacctataaat
tcattagtacctgatcccgcaacagtgccaagccatcacgcaaaagacgttaatagcgtt
ataaggaatttagatatagctacgatggcagtaatagccccaacaacactgatgcatatg
cactttatcaatataaccttaaaagataaggtagagaaaaaagatatacttagcgttcta
gaaaatactccaaggatagttctaatctcctcaaagtatgatgcagaagctacagcggaa
ttagtagaagtggcgagagatttgaaaagggacagaaatgatattccagaggtaatgata
tttagtgattcgatttacgttaaggatgacgaggtcatgctcatgtacgcggtacatcaa
gaatcaatagtggtaccagaaaatatagatgcaataagggcttccatgaaattaatgagt
gcagaagattccatgagaattactaatgaaagtttaggaatattaaaggggtatctaata
tga

DBGET integrated database retrieval system