KEGG   Sulfolobus solfataricus 98/2: Ssol_1863Help
Entry
Ssol_1863         CDS       T02126                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00260  Glycine, serine and threonine metabolism
sol00750  Vitamin B6 metabolism
sol01100  Metabolic pathways
sol01110  Biosynthesis of secondary metabolites
sol01120  Microbial metabolism in diverse environments
sol01230  Biosynthesis of amino acids
Module
sol_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssol_1863
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ssol_1863
Enzymes [BR:sol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ssol_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 TF_Zn_Ribbon HypA zinc_ribbon_2 Mu-like_Com
Motif
Other DBs
NCBI-ProteinID: ACX92075
UniProt: D0KTK6
Position
complement(1654169..1655359)
Genome map
AA seq 396 aa AA seqDB search
MKCLNCGYETEIDQSQILCPRCGGLLEIILEPPKDFSFSKLRGRGVWRYKELIAGRYKNI
VSINEGNTPLIRSSNINDNLYFKFEGLNPTGSFKDRGMTVAVSSAVSLNYKTVIAASTGN
TAASAAAYAARAGIKSFIVLPKGKVALGKLAQSILYGSVILEVDGSFDVAMDAVMRLYKD
LKVVYPLNSFNPWRLEGQKTIAFEIAEELGVPDNVIVPVGNAGNIYAIWKGFNELVKTGV
INTIPRMIGIQAEGASPIVTAIIKGKDSPDFIENPDTVATAIRIGKPVNWQKAMKAIRES
NGTAIAVSDSEILDAQKTLARKEGIGAEPASAAALAGYIKAINEKVVDKDEKTVLILTGH
SLKDPDSMTKAEAKRILVNPLHMEKIILGEINGSNS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgcttgaattgtggatatgaaacggaaatagatcaaagtcagatattatgtcca
agatgtggaggactattagaaattatactagaaccaccaaaggacttctctttcagtaaa
ttgagaggaagaggagtttggagatataaagaattaatagcaggcagatacaaaaatatt
gtaagcataaatgagggaaataccccactaattagatcctcaaatataaatgataatctt
tattttaaatttgaagggcttaatccaactggtagttttaaggatagaggaatgacagtg
gcagttagttctgcggtaagcttgaattacaaaactgtaatagccgcatccactggaaat
actgcagcttctgcagctgcttatgctgcaagagctggtataaagagctttatcgtctta
cctaaaggtaaggtagcattaggtaaattagctcaatcaatactttatggctcagttatt
ttagaagttgatggaagttttgacgttgctatggatgcagtaatgagattatataaggat
ttaaaagtagtatatccattaaattcctttaatccatggagattagaaggacaaaagaca
atcgcatttgagatagcagaagaactaggagttcctgacaacgtgatagtcccggtaggc
aatgcaggcaatatctacgccatatggaaaggatttaatgagctagttaaaactggagtt
attaatactattcctagaatgattggaatccaagctgagggcgcatcaccaatagttacc
gcaataataaaaggaaaagattctccagatttcatagaaaatccagatactgtagcaaca
gcaataaggatagggaaaccagttaattggcaaaaagcgatgaaagcaataagggaatct
aatggaaccgcaatagctgtatctgattccgagatattagacgcacagaagaccctagct
agaaaagagggcataggagctgagcctgcttcagcagctgccttagctggttatattaag
gcaataaatgaaaaggtggtagataaagatgaaaaaacagttttaatcctaacaggacat
tcgttaaaggatcccgatagtatgacaaaagctgaggctaaaagaatattagttaatcct
ttacatatggaaaaaattatcctaggtgagataaatggctctaatagttaa

DBGET integrated database retrieval system