KEGG   Sulfolobus solfataricus 98/2: Ssol_1871Help
Entry
Ssol_1871         CDS       T02126                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssol_1871
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssol_1871
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssol_1871
Enzymes [BR:sol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ssol_1871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1663406..1664128
Genome map
AA seq 240 aa AA seqDB search
MLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVKGLDIW
PLIEDIRKDVGVPIIALTYLEDWVDQLENFLNMIKDVKLDGILFPDLLIDYIDDLDKIDG
IIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINRVRNLV
ENKLIVGFGLSSESDLRDALSAGADGIAIGTVFIEEIERNGVKSAINLVKKFRAILDEYK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtagtctatatgacgttaggttatccaaatgttcaaagttttaaggattttatt
attggggcagttgaaaatggagctgatatattagagcttggaatcccccctaagtatgct
aagtatgatggtccagttataaggaagagttatgataaagtaaaagggctagatatttgg
cccttaatagaagatattaggaaagatgtgggtgttcccataattgcacttacttattta
gaagattgggttgatcagctagagaattttctaaatatgataaaagacgtcaaactggac
ggaattctatttccagatttacttattgattatatagatgatttggataaaattgatggg
ataataaaaaataaaggattaaaaaacgttatttttacatctccttcagtaccagatctt
ctaatccacaaagtctctaagattagcgatttattcttatattatggtgtcagaccaact
actggcgtacctataccagtatcagttaagcaattgattaatagagttagaaatctagtt
gagaataagctaatagtaggatttggcttatcaagcgagtcagatttaagagatgctcta
agtgctggtgctgacggaatagcaattggaactgtgttcatagaggaaattgagaggaat
ggtgtaaaatctgcaataaatttagttaaaaaatttagggcgatattagatgaatataaa
tga

DBGET integrated database retrieval system