KEGG   Sulfolobus solfataricus 98/2: Ssol_1876Help
Entry
Ssol_1876         CDS       T02126                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ssol_1876
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssol_1876
Enzymes [BR:sol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ssol_1876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1667594..1668340
Genome map
AA seq 248 aa AA seqDB search
MPRYLKGWLKDVVQLSLRRPSFRASRQRPIISLNERILEFNKRNITAIIAEYKRKSPSGL
DVERDPIEYSKFMERYAVGLSILTEEKYFNGSYETLRKIASSVSIPILMKDFIVKESQID
DAYNLGADTVLLIVKILTERELESLLEYARSYGMEPLIEINDENDLDIALRIGARFIGIN
SRDLETLEINKENQRKLISMIPSNVVKVAESGISERNEIEELRKLGVNAFLIGSSLMRNP
EKIKEFIL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgccacgttatcttaaaggatggcttaaagacgtcgtacaattatctttaaggaggccc
tcatttagggcttcaagacaaaggccaattatttccttaaacgaaagaattttagaattt
aataagcgcaatatcacagctataatagccgaatataaacgcaaatctccctctggatta
gatgttgaaagggatccaatagaatattcaaaattcatggaaaggtatgcagtaggtctt
agcatattaactgaggagaagtactttaatggttcatatgaaactttgagaaagatagcc
agttcagtttcaattcccatactaatgaaggattttatcgttaaggaatcgcaaattgat
gatgcatataacctaggtgctgatactgtattgctaatagtcaaaatactaactgaaaga
gaattagagagtttattggaatatgccagaagttatggtatggaaccattgatagaaatt
aatgacgaaaatgatttagatatagccctaaggataggggctagatttataggaattaat
tcaagagatctagaaacccttgagataaataaggagaatcagagaaagcttatatccatg
ataccatccaatgtggtaaaggtggcagaaagtggaatttctgagaggaatgaaatagaa
gaattaaggaaattaggtgttaacgctttcctaatcggatcatcactgatgcgaaaccca
gaaaagattaaagaatttatactatag

DBGET integrated database retrieval system