KEGG   Sulfolobus solfataricus 98/2: Ssol_2113Help
Entry
Ssol_2113         CDS       T02126                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00260  Glycine, serine and threonine metabolism
sol00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sol01100  Metabolic pathways
sol01110  Biosynthesis of secondary metabolites
sol01130  Biosynthesis of antibiotics
sol01230  Biosynthesis of amino acids
Module
sol_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ssol_2113
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ssol_2113
Enzymes [BR:sol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ssol_2113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACX92319
UniProt: D0KUA0
Structure
PDB: 

Jmol
Position
1893433..1894722
Genome map
AA seq 429 aa AA seqDB search
MAMKIRIDLPQDEIPMQWYNILPDLPEELPPPQDPTGKSLELLKEVLPGKVLELEFTKER
YVNIPDEVLERYLQVGRPTPIIRAKRLEEYLGNSIKIYLKMESYTYTGSHKINSALAHVY
YAQLDNARFVTTETGAGQWGSAVALASALFKMKAHIFMVRTSFYAKPYRKYMMQMYGAEV
HPSPSDLTEFGRQLLAKDPKHPGSLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAG
MEAKKQMEIIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRIYIASGSLEVPKMT
KGIYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLMNKGIVQARDY
SQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGEKKTVLVSFSGHGLLDLG
NYASVLFKE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaaaataagaatagatttgccccaagatgagatacccatgcaatggtataat
atcttgccagatctaccagaagaattacctccacctcaagacccaactggtaaatcttta
gaattactcaaggaggttctaccgggcaaggtactagagttggagttcactaaggaaaga
tacgtaaatataccggatgaggttttagagagatatttgcaagttggaagaccaactcca
ataatcagagctaaaaggttagaggagtatctaggaaatagcatcaaaatctacttgaaa
atggagagctatacctacactggttcccacaaaataaacagtgctttagcgcacgtatat
tacgctcaattagataatgcgagattcgttacaacagaaactggagctggacagtgggga
tcagcggttgctctagcttcagccctatttaagatgaaggcacatatcttcatggttaga
acaagcttctatgccaaaccctatagaaagtacatgatgcaaatgtatggagcagaagtt
catccttctccttcagatctaaccgagtttggtagacaattgttggccaaggaccctaaa
cacccaggttctctaggtattgccataagtgatgcagtagaatacgcccataaaaatggt
ggaaaatacgtagttggtagtgtagttaactcagatataatgtttaagacaatagctgga
atggaggctaagaagcaaatggaaataattggtgaagatccagattacataataggagta
gtgggtggaggatcgaattacgcagcgttggcttatccatttttaggagacgagttaagg
agtggtaaagttaggagaatatacattgcttctggatctttagaggtacctaaaatgact
aaaggcatttataagtacgattatccagatactgccaaattattaccaatgcttaaaatg
tacactataggttcagactttgtgccacccccagtttatgcaggtggattaagatatcat
ggagtagctcccacacttagtctcttaatgaataaaggaattgtacaagcaagagattac
tctcaagaagagtcgttcaagtgggctaaactattctcagagttagaaggatatatacca
gctcccgagacttcacatgcattacctatattggctgaaatagctgaagaagctaagaag
agtggagaaaagaagacagtattggttagcttctctgggcacggattactagatttgggc
aactacgcctctgtattatttaaggagtaa

DBGET integrated database retrieval system