KEGG   Sulfolobus solfataricus 98/2: Ssol_2170Help
Entry
Ssol_2170         CDS       T02126                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_2170
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2170
   00020 Citrate cycle (TCA cycle)
    Ssol_2170
   00620 Pyruvate metabolism
    Ssol_2170
   00640 Propanoate metabolism
    Ssol_2170
   00650 Butanoate metabolism
    Ssol_2170
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2170
   00680 Methane metabolism
    Ssol_2170
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ssol_2170
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ssol_2170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1955556..1956449)
Genome map
AA seq 297 aa AA seqDB search
MSSQVTPKRMPKFYRGNAACPGCPIPKELDVALEVLGNKTVLVVPASCTTIIMGDTNGMP
STVPVVHSAFGAAAAIGSGIVRSLRMRGDNDAIVAVWAGDGSTGDIGFAAVSGAAERNED
ILYICYDNEAYMNTGIQRSGLTPKGAWTTTTPEGKREVKKPLPFIIAEHKVPYVATASIA
YIYDYEAKMRKAKQIRGFRYIHLLSPCPPGWRFDSKLTIDIAKLAVETGVWPLFEIENGE
FKLTSVSKTLVEKKNRKPVAEYLKLQGRFKQLTEEQIKGIQEEIDEMWEEIKRLIKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagtcaagtaacaccgaagagaatgcctaaattctacagaggaaatgctgcttgt
ccaggctgtccaatacctaaagagttagacgtagccctagaagttttagggaataagaca
gtgctagtagttccagcttcatgtactacgataataatgggagatactaatgggatgcct
tcaactgtaccagtagttcacagtgcctttggagcagctgctgcaataggttctgggatt
gttagatccctaagaatgaggggagataatgacgcaatagtggctgtttgggctggtgat
ggttctactggtgatataggatttgccgcagttagtggtgctgctgagagaaatgaggat
atcctttacatatgctatgataacgaagcttatatgaatactggaattcagcgttcaggc
ttaactcctaagggggcttggactactacaactcctgaaggtaagagagaggttaaaaag
cctttaccattcatcattgcagaacataaagtaccatatgttgccactgcgtcaattgct
tacatatatgattatgaagctaagatgaggaaagctaaacagattcgaggatttagatat
atacacttattgtccccatgtccacctggttggcgtttcgattctaaattaactatcgat
attgcaaaacttgcagttgagactggagtttggccactctttgaaatagaaaatggtgaa
tttaaactaactagtgtgagtaagacgttagttgagaagaagaataggaaaccagtagcg
gagtatttaaaattacaaggaagatttaaacagctcactgaagaacaaataaagggcata
caagaggagattgacgagatgtgggaggaaattaaaagactaattaagaagtaa

DBGET integrated database retrieval system