KEGG   Sulfolobus solfataricus 98/2: Ssol_2431Help
Entry
Ssol_2431         CDS       T02126                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ssol_2431
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Ssol_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2231506..2232540
Genome map
AA seq 344 aa AA seqDB search
MKAVRIHEYNKPLSLDEVNKPRVSGPYDIVVRIRGAGVCRTDLHIIEGVWKDVLNPKLPF
TIGHENVGIIEEKGNAVDWLDVGDQVILHPYITCRHCRACRSGNDMHCPYGKFPGLDGTD
GGYAEYLRTSAFSAIKIPKGIDIIPMAPLADAGITAYHAVKKISQYLYPGSIVGVIGVGG
LGHIGIQALKAITPARVIAIDISEEKTKLAKELGADEVVIAGKDSGVSDVLKLTDNIGVD
AIIDFVGEHSTPQNALRMIRKGGIYSIVGYGGEFKNSTLDFINREIMVVGNLVGTYNELS
ELVTLYVQNKVKLKVKTFPLEEANSALEELKAGRILGRAVLVPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttagaattcatgaatataataaacctttgtccttagatgaggttaataaa
cctagggtctctggaccatatgatatagtagttagaattagaggagcgggagtctgtagg
actgacttgcacattatcgaaggagtatggaaagacgtactaaatcctaagttaccattt
accataggtcacgaaaacgtcggtataatagaggaaaagggtaatgccgtagactggtta
gatgtgggagatcaagtaatattacatccctacattacttgtagacattgtagagcgtgt
aggtctggaaacgatatgcattgtccatatgggaaattccctggattagacggtactgat
ggcggttatgcagaatatttaaggacctcagctttctctgccataaagatccccaagggg
attgatataataccaatggcacccttagctgatgccggaataactgcataccatgccgta
aagaagatttctcaatacctctatcctggaagcattgtaggtgttattggtgttggtgga
ctaggccatattggtattcaagcccttaaggcaatcactccagctagagttattgcaata
gatataagtgaagagaagactaagctagctaaggaattgggtgctgatgaagtagtaata
gcgggaaaggatagtggcgttagtgatgtcttgaaattgaccgacaacataggtgttgac
gcaatcatagattttgtcggggaacactccactcctcaaaatgccttaaggatgataagg
aagggaggaatatactcaattgttggctatggcggagaatttaaaaatagcactttagat
ttcataaatagggagatcatggtggttggtaatctagtgggtacttataatgagttaagc
gagttagtaaccttatacgttcaaaataaggtaaaattaaaggtaaagacgttcccctta
gaggaggctaatagcgcacttgaggagttgaaagctggaaggattttaggaagggcagtc
ttagtgcctagctaa

DBGET integrated database retrieval system