KEGG   Sulfolobus solfataricus 98/2: Ssol_2702Help
Entry
Ssol_2702         CDS       T02126                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_2702
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2702
   00620 Pyruvate metabolism
    Ssol_2702
   00640 Propanoate metabolism
    Ssol_2702
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2702
   00680 Methane metabolism
    Ssol_2702
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ssol_2702
Lipid biosynthesis proteins [BR:sol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ssol_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2476969..2478465
Genome map
AA seq 498 aa AA seqDB search
MASYEEVRRSFSWSEVIRYLDENPLDVLTSHDGIAVKRFTKNAMEEISFSDLKRKALRLA
LYLKEFHNIKKGDVIAILASKKIQQIIVFLATLSLGAIYQPLFTAFGPEAIKMRTRDVKP
KIIFCQDDQKDKINDAILFSKFDELLSYGELKEIEKINWDDAIILLYTSGTTGTPKGALI
AKRLFLNIYVYMKYGIGVRENDVFWNPADPGWAYGLYYGIIGPLMFGKTIIFLDEPFNPE
RTMEFMEENKVTNFAFAPTAYRMIAGTVKKKYDLVLERASSAGEPLNPEVIRWFMDKYNV
TIKDHYGQTEVGMVVYNGWGYDAKVKIGSMGLPALGYEVDIIEDIIAVKRDSPGFHFLGY
LNNPEKTKESFRGDWYLTGDNAYKDEEGYLWFVGRKDDVVKVSGYRIGPFEVESVLLEFP
AVLESAVVADEDPIRGHVLHAYIVLKSGYTPSEELKKEIIDFVNTKYSMHVHLERVDFVD
KLPKTESGKIQRYLLRKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctagttatgaagaagttaggagaagtttttcgtggagtgaggtaattagatattta
gacgagaacccattagacgttttgacttctcatgacggtatagcagttaagagattcact
aagaacgctatggaggagataagcttctcagatcttaaaagaaaggcattaagacttgcc
ttatatctcaaggagtttcataacattaaaaagggtgatgtaatagcaatattagcttca
aagaagattcaacaaatcatagtatttttagcaactctctccctaggagcaatttatcaa
ccattatttactgcatttgggccagaggcaattaagatgaggactagagatgtaaaacca
aaaattatcttttgtcaagatgaccaaaaggataagataaatgatgcaatactcttctcc
aagtttgatgaattattaagttacggtgaattgaaagagattgaaaagataaattgggat
gatgcaataattttactttacacttctggtactacgggaacacctaaaggggccctaatc
gctaagaggctatttcttaacatttatgtctacatgaaatatggtataggtgttagggaa
aatgacgtgttttggaaccccgcagatcctggatgggcttatgggctatattatggtata
ataggaccgctaatgtttgggaaaactataatctttcttgacgaaccatttaacccagaa
aggacaatggagttcatggaggaaaataaggttactaattttgctttcgcacctacggca
tatagaatgatagctggaacggttaagaagaagtatgatttagtattggaaagagcgagt
tctgcaggtgaaccacttaacccagaagttataagatggtttatggataagtacaatgtt
actatcaaggatcattatggacaaactgaagttggaatggtagtttataatggctgggga
tatgacgcaaaagtaaaaatagggagtatgggactacctgcacttggttatgaggtcgat
ataatagaggatattatagctgtcaagagagattctccaggtttccacttcttgggatat
ctaaacaatccagagaagaccaaggaatcatttcgaggcgattggtacttgactggtgat
aatgcgtataaagatgaggaaggatatttatggtttgttggaaggaaggacgatgtggtt
aaggtatctggttacaggataggtccatttgaagttgagagcgtacttctagaatttccc
gcagtactagaatctgctgttgttgccgatgaagatccaatacgaggacatgtattacat
gcttatattgtactcaaaagtggatatactccaagtgaggaactaaagaaggagattatt
gattttgtaaatactaaatattctatgcacgtacatctagaaagggttgactttgttgat
aaattgccaaagactgagagtggtaaaatacaaagatatctacttagaaagaaataa

DBGET integrated database retrieval system