KEGG   Sulfolobus solfataricus 98/2: Ssol_2788Help
Entry
Ssol_2788         CDS       T02126                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00010  Glycolysis / Gluconeogenesis
sol00620  Pyruvate metabolism
sol00640  Propanoate metabolism
sol00680  Methane metabolism
sol00720  Carbon fixation pathways in prokaryotes
sol01100  Metabolic pathways
sol01110  Biosynthesis of secondary metabolites
sol01120  Microbial metabolism in diverse environments
sol01130  Biosynthesis of antibiotics
sol01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2788
   00620 Pyruvate metabolism
    Ssol_2788
   00640 Propanoate metabolism
    Ssol_2788
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2788
   00680 Methane metabolism
    Ssol_2788
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ssol_2788
Lipid biosynthesis proteins [BR:sol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ssol_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N PATR
Motif
Other DBs
NCBI-ProteinID: ACX92871
UniProt: D0KPW7
Position
2549576..2551402
Genome map
AA seq 608 aa AA seqDB search
MVFNPDKEWIENSNVYKFMIKRNLNRLEDFVRYTYENPEFWDQFVKLIGVEFKEPYAKVL
DLSRGKQWPQWFIGGKLNIGDQLRDSSDVFIKWMDEDLNTRTVTYSQILNESKSIASWLK
KIGLKKGDRVAIYMPMIPEIVSVMLGAIRVGTIIVPLFSGFGPEPIRVRVEDSEAKVIFT
VDKSIRRGKEVDMLKNLEGLNDNITKVVLNRGGTKGDFYEYKDVIKTAGDYVEDTSTEDP
MMIIYTSGTTGKPKGCVHTHDGFPIKASADIYFQFDLKNGETLMWVTDMGWMMGPWMVFG
SLLLNAKMGMIEGYTSGEVLQKFVEDMKVDVLGVSASLVRALRSQGEVKLNVRLTGNTGE
PIDSESWYWLFNASGKNPIINYSGGTEISGGILGNYVIKKIKPSSFNGPSPGINASVFNE
EGKDAPPNVEGELVVLSVWPGMTRGFWRNPERYIETYWSVWKDVWVHGDLAYRDEEGYFY
IVGRSDDTIKVAGKRVGPAEIESVLNSFPNVVESACIGIPDPMKGEKIVCFVVSKVSGIE
NQLIEYTEDKLGKAFAPSEIKIVKELPKTRNAKIMRRLIRAIYLNKPLGDISSLENPSAL
EEIKKAIS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggtatttaatccagataaggaatggatagagaacagtaacgtatataagttcatgatt
aaaaggaaccttaatagattagaagacttcgtaaggtatacatatgagaatcctgaattt
tgggaccagtttgtaaagcttattggagtggaatttaaagaaccttatgccaaggttttg
gatctgagcagaggaaaacaatggccacaatggttcataggagggaagttaaacattgga
gatcaattacgtgatagttctgatgtgttcattaagtggatggatgaagacctcaacacc
agaactgtaacttattctcaaatactaaatgagagcaagtctattgcaagttggttaaag
aagataggtttgaagaagggagatagggtcgctatttacatgccaatgatcccggaaata
gtatcagtaatgctgggagcaataagggtagggacgataatcgtacccttattttccgga
tttggtccagagcccataagggttagagtggaggatagtgaggcgaaagtaatcttcaca
gttgataagagcattagaagaggaaaagaagtcgacatgttaaaaaatctagaaggacta
aacgataatataactaaagtagtattgaatagaggaggcactaagggtgatttttatgag
tataaggatgtcataaaaactgctggagattatgtagaagataccagtactgaagaccca
atgatgataatttacacttctggaactactggaaaacccaaaggatgcgttcatactcac
gatgggtttccaataaaagcttcagctgacatttacttccaattcgatttgaaaaatgga
gagacgttaatgtgggttactgacatggggtggatgatgggaccctggatggtatttgga
tcactcttactaaacgctaaaatgggaatgattgaaggatatacaagtggggaagtccta
cagaaattcgttgaagatatgaaagttgatgttttaggggtctcagctagtctagttagg
gcactgagaagtcaaggcgaagttaagctaaacgttaggttaactggaaacactggagaa
ccaattgattcggaaagctggtattggttattcaacgccagtggaaagaaccccataata
aactactctggaggtactgaaatctctggaggtattttggggaattacgttataaagaag
ataaagccatcttcatttaatggaccttctccgggaattaacgcctcagtatttaatgag
gaaggaaaagacgccccaccaaatgttgaaggagagttagtcgtattaagtgtttggcca
ggtatgactagaggattttggagaaacccggaaaggtatatagagacctactggtcagtg
tggaaagatgtatgggttcatggagatttggcttatagagacgaagaagggtatttttac
atcgtaggtaggagtgatgatacgataaaggttgctgggaagagagtaggtccggctgaa
atcgaaagcgtattaaattcattcccaaacgtagtggaatcagcatgtataggaatacct
gatccgatgaagggggagaaaatagtctgttttgtagtctctaaggttagtgggattgaa
aatcaattaatagaatacacagaggataaactgggtaaggcatttgcaccatctgaaata
aagattgttaaggagctacctaagactagaaatgctaaaataatgaggagattgataaga
gccatatatttaaataaacccttaggagatatatcctcactggaaaatccgtcagctttg
gaggaaattaagaaggccatcagttag

DBGET integrated database retrieval system