KEGG   Sulfolobus solfataricus 98/2: Ssol_2788Help
Entry
Ssol_2788         CDS       T02126                                 

Definition
(RefSeq) AMP-dependent synthetase and ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ssol_2788
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2788
   00620 Pyruvate metabolism
    Ssol_2788
   00640 Propanoate metabolism
    Ssol_2788
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2788
   00680 Methane metabolism
    Ssol_2788
Enzymes [BR:sol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ssol_2788
Lipid biosynthesis proteins [BR:sol01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ssol_2788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2549576..2551402
Genome map
AA seq 608 aa AA seqDB search
MVFNPDKEWIENSNVYKFMIKRNLNRLEDFVRYTYENPEFWDQFVKLIGVEFKEPYAKVL
DLSRGKQWPQWFIGGKLNIGDQLRDSSDVFIKWMDEDLNTRTVTYSQILNESKSIASWLK
KIGLKKGDRVAIYMPMIPEIVSVMLGAIRVGTIIVPLFSGFGPEPIRVRVEDSEAKVIFT
VDKSIRRGKEVDMLKNLEGLNDNITKVVLNRGGTKGDFYEYKDVIKTAGDYVEDTSTEDP
MMIIYTSGTTGKPKGCVHTHDGFPIKASADIYFQFDLKNGETLMWVTDMGWMMGPWMVFG
SLLLNAKMGMIEGYTSGEVLQKFVEDMKVDVLGVSASLVRALRSQGEVKLNVRLTGNTGE
PIDSESWYWLFNASGKNPIINYSGGTEISGGILGNYVIKKIKPSSFNGPSPGINASVFNE
EGKDAPPNVEGELVVLSVWPGMTRGFWRNPERYIETYWSVWKDVWVHGDLAYRDEEGYFY
IVGRSDDTIKVAGKRVGPAEIESVLNSFPNVVESACIGIPDPMKGEKIVCFVVSKVSGIE
NQLIEYTEDKLGKAFAPSEIKIVKELPKTRNAKIMRRLIRAIYLNKPLGDISSLENPSAL
EEIKKAIS
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggtatttaatccagataaggaatggatagagaacagtaacgtatataagttcatgatt
aaaaggaaccttaatagattagaagacttcgtaaggtatacatatgagaatcctgaattt
tgggaccagtttgtaaagcttattggagtggaatttaaagaaccttatgccaaggttttg
gatctgagcagaggaaaacaatggccacaatggttcataggagggaagttaaacattgga
gatcaattacgtgatagttctgatgtgttcattaagtggatggatgaagacctcaacacc
agaactgtaacttattctcaaatactaaatgagagcaagtctattgcaagttggttaaag
aagataggtttgaagaagggagatagggtcgctatttacatgccaatgatcccggaaata
gtatcagtaatgctgggagcaataagggtagggacgataatcgtacccttattttccgga
tttggtccagagcccataagggttagagtggaggatagtgaggcgaaagtaatcttcaca
gttgataagagcattagaagaggaaaagaagtcgacatgttaaaaaatctagaaggacta
aacgataatataactaaagtagtattgaatagaggaggcactaagggtgatttttatgag
tataaggatgtcataaaaactgctggagattatgtagaagataccagtactgaagaccca
atgatgataatttacacttctggaactactggaaaacccaaaggatgcgttcatactcac
gatgggtttccaataaaagcttcagctgacatttacttccaattcgatttgaaaaatgga
gagacgttaatgtgggttactgacatggggtggatgatgggaccctggatggtatttgga
tcactcttactaaacgctaaaatgggaatgattgaaggatatacaagtggggaagtccta
cagaaattcgttgaagatatgaaagttgatgttttaggggtctcagctagtctagttagg
gcactgagaagtcaaggcgaagttaagctaaacgttaggttaactggaaacactggagaa
ccaattgattcggaaagctggtattggttattcaacgccagtggaaagaaccccataata
aactactctggaggtactgaaatctctggaggtattttggggaattacgttataaagaag
ataaagccatcttcatttaatggaccttctccgggaattaacgcctcagtatttaatgag
gaaggaaaagacgccccaccaaatgttgaaggagagttagtcgtattaagtgtttggcca
ggtatgactagaggattttggagaaacccggaaaggtatatagagacctactggtcagtg
tggaaagatgtatgggttcatggagatttggcttatagagacgaagaagggtatttttac
atcgtaggtaggagtgatgatacgataaaggttgctgggaagagagtaggtccggctgaa
atcgaaagcgtattaaattcattcccaaacgtagtggaatcagcatgtataggaatacct
gatccgatgaagggggagaaaatagtctgttttgtagtctctaaggttagtgggattgaa
aatcaattaatagaatacacagaggataaactgggtaaggcatttgcaccatctgaaata
aagattgttaaggagctacctaagactagaaatgctaaaataatgaggagattgataaga
gccatatatttaaataaacccttaggagatatatcctcactggaaaatccgtcagctttg
gaggaaattaagaaggccatcagttag

DBGET integrated database retrieval system