KEGG   Sulfolobus solfataricus 98/2: Ssol_2857Help
Entry
Ssol_2857         CDS       T02126                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00010  Glycolysis / Gluconeogenesis
sol00020  Citrate cycle (TCA cycle)
sol00620  Pyruvate metabolism
sol00640  Propanoate metabolism
sol00650  Butanoate metabolism
sol00680  Methane metabolism
sol00720  Carbon fixation pathways in prokaryotes
sol01100  Metabolic pathways
sol01120  Microbial metabolism in diverse environments
sol01130  Biosynthesis of antibiotics
sol01200  Carbon metabolism
Module
sol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2857
   00020 Citrate cycle (TCA cycle)
    Ssol_2857
   00620 Pyruvate metabolism
    Ssol_2857
   00640 Propanoate metabolism
    Ssol_2857
   00650 Butanoate metabolism
    Ssol_2857
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2857
   00680 Methane metabolism
    Ssol_2857
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ssol_2857
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ssol_2857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_7 Fer4_2 Fer4_17 Fer4_9 Fer4_16 Fer4_10 Fer4_8 Fer4_22 Fer4_13 Fer4_6 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ACX92934
UniProt: D0KQ30
Position
2616405..2617496
Genome map
AA seq 363 aa AA seqDB search
MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFGRYGDSPERNGVPAKY
YVGIGDGVNEEDLIGYSTRVEPDLVDVIIVLDDTLLKGVESWAWQGVQPINLKLKSNGTM
LVTSTKRINELLKMIPKKDFNWTLGVIKTEPSFSGLWAFKDDLTMEKVWGGLAKLRPDII
DLDHLLKYVTKKQDANKRVSAVREAYSSVDYRTVMKGEGIDFVYNPPRLLTWQEMLEGTV
IPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWVYCPDECFDETPDGYYDIAYDYC
VGCGICAEVCPVKDCIVMVDESMFTDYRRPYEMWKEDKAKYKEWLKTVRQARKERVYVPG
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaaaagatgaagtgaagtatgtagagatagtgtatagaggtatcttccagaaa
agattagcaaagtacattgcagaaggaatcgtttacactgccagggaaatggggagacca
gccttgtcttttggcagatatggggactccccagaaagaaacggagtaccagcaaaatac
tatgttggaataggagatggtgtaaatgaagaagacctaataggttactctacaagagta
gaaccagatctagtggatgtgattatagtactagacgataccctattaaagggtgtagaa
tcgtgggcatggcaaggagttcaacccataaacctcaaactaaagagtaacgggacaatg
ttggtaacttctaccaagagaattaacgagttattaaaaatgatacctaaaaaggacttt
aattggactctaggagtaataaaaactgaaccatcattttcgggactatgggcatttaag
gatgacttaaccatggagaaagtctggggaggattagcaaagctaagacctgatatcata
gatttagaccatttacttaaatatgtaaccaaaaaacaagatgctaacaagagagtatct
gcagtaagagaagcatattcctcagtagattatagaactgtgatgaaaggtgagggaata
gatttcgtatataatccacctaggttactaacatggcaggaaatgttagagggtacagta
attccagcagttccgaggggaaagaggaatgaactctttaagagaggaactacaaaattt
gaaagacctacagtagatttcgatacttgtatcaaatgtaaactatgttgggtgtactgt
ccagatgaatgtttcgatgaaactccagatggatattatgatatagcttacgactactgt
gtaggatgcggaatatgcgctgaagtgtgcccagttaaggattgcatagtaatggtagac
gaatcgatgttcacggattacagaaggccatatgagatgtggaaagaggataaagcaaag
tataaggaatggttaaaaactgtaaggcaagctaggaaggaaagagtttacgttccgggg
ttgggaagatga

DBGET integrated database retrieval system