KEGG   Sulfolobus solfataricus 98/2: Ssol_2857Help
Entry
Ssol_2857         CDS       T02126                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sol01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sol00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sol00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sol00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sol00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sol00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sol00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sol00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sol00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2616405..2617496
Genome map
AA seq 363 aa AA seqDB search
MGVKDEVKYVEIVYRGIFQKRLAKYIAEGIVYTAREMGRPALSFGRYGDSPERNGVPAKY
YVGIGDGVNEEDLIGYSTRVEPDLVDVIIVLDDTLLKGVESWAWQGVQPINLKLKSNGTM
LVTSTKRINELLKMIPKKDFNWTLGVIKTEPSFSGLWAFKDDLTMEKVWGGLAKLRPDII
DLDHLLKYVTKKQDANKRVSAVREAYSSVDYRTVMKGEGIDFVYNPPRLLTWQEMLEGTV
IPAVPRGKRNELFKRGTTKFERPTVDFDTCIKCKLCWVYCPDECFDETPDGYYDIAYDYC
VGCGICAEVCPVKDCIVMVDESMFTDYRRPYEMWKEDKAKYKEWLKTVRQARKERVYVPG
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaaaagatgaagtgaagtatgtagagatagtgtatagaggtatcttccagaaa
agattagcaaagtacattgcagaaggaatcgtttacactgccagggaaatggggagacca
gccttgtcttttggcagatatggggactccccagaaagaaacggagtaccagcaaaatac
tatgttggaataggagatggtgtaaatgaagaagacctaataggttactctacaagagta
gaaccagatctagtggatgtgattatagtactagacgataccctattaaagggtgtagaa
tcgtgggcatggcaaggagttcaacccataaacctcaaactaaagagtaacgggacaatg
ttggtaacttctaccaagagaattaacgagttattaaaaatgatacctaaaaaggacttt
aattggactctaggagtaataaaaactgaaccatcattttcgggactatgggcatttaag
gatgacttaaccatggagaaagtctggggaggattagcaaagctaagacctgatatcata
gatttagaccatttacttaaatatgtaaccaaaaaacaagatgctaacaagagagtatct
gcagtaagagaagcatattcctcagtagattatagaactgtgatgaaaggtgagggaata
gatttcgtatataatccacctaggttactaacatggcaggaaatgttagagggtacagta
attccagcagttccgaggggaaagaggaatgaactctttaagagaggaactacaaaattt
gaaagacctacagtagatttcgatacttgtatcaaatgtaaactatgttgggtgtactgt
ccagatgaatgtttcgatgaaactccagatggatattatgatatagcttacgactactgt
gtaggatgcggaatatgcgctgaagtgtgcccagttaaggattgcatagtaatggtagac
gaatcgatgttcacggattacagaaggccatatgagatgtggaaagaggataaagcaaag
tataaggaatggttaaaaactgtaaggcaagctaggaaggaaagagtttacgttccgggg
ttgggaagatga

DBGET integrated database retrieval system