KEGG   Sulfolobus solfataricus 98/2: Ssol_2859Help
Entry
Ssol_2859         CDS       T02126                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
sol  Sulfolobus solfataricus 98/2
Pathway
sol00010  Glycolysis / Gluconeogenesis
sol00020  Citrate cycle (TCA cycle)
sol00620  Pyruvate metabolism
sol00640  Propanoate metabolism
sol00650  Butanoate metabolism
sol00680  Methane metabolism
sol00720  Carbon fixation pathways in prokaryotes
sol01100  Metabolic pathways
sol01120  Microbial metabolism in diverse environments
sol01130  Biosynthesis of antibiotics
sol01200  Carbon metabolism
Module
sol_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sol00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ssol_2859
   00020 Citrate cycle (TCA cycle)
    Ssol_2859
   00620 Pyruvate metabolism
    Ssol_2859
   00640 Propanoate metabolism
    Ssol_2859
   00650 Butanoate metabolism
    Ssol_2859
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ssol_2859
   00680 Methane metabolism
    Ssol_2859
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ssol_2859
Enzymes [BR:sol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ssol_2859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N SMC_Nse1
Motif
Other DBs
NCBI-ProteinID: ACX92936
UniProt: D0KQ32
Position
2618759..2619775
Genome map
AA seq 338 aa AA seqDB search
MVEKELEEKVYKSIIKTIKDTPLEEFYTSGHRTCQGCESALVMRFLAKAAGPRTIVIGAT
GCMYVANTTYYTTSWIVPWVHTQLGGTGAAALGTAAALRALMRKGKIKQEPINVIAFCGD
LGCADMGLSGVSNAMTYDYNLLIILYDNESSANTDIQETSMTPFGAQTSFSRPGKQRRIM
KKRWKKSVVPMIIAGHRNVRYAATMTPAYPLDSMNKIRKALTIGGPTFIHSLDPCPKGWD
YDPKFSHELGVLAVETGLWPLYEYIDGEIVYNEPTKSIVEGRMKRKPVKEYLEKQGRFSH
FTEEDIEYVQRMVDEMYEEWEIPGVMPIKSINAKISDK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggttgaaaaggaattggaagaaaaagtgtataagtctataattaagacaataaaagac
acaccgttagaggagttctatacatctggtcataggacttgccaaggatgcgagtcggca
ctagtgatgagatttttagctaaagctgctggaccaagaacaatagttataggagctact
ggatgcatgtatgtagcaaatactacatattatactacgtcatggatagttccatgggtt
cacacacaactgggaggaacaggtgcagctgcattaggtactgccgctgcacttagggca
ttaatgaggaaaggaaaaataaagcaagaacctataaacgtgatagccttctgtggagac
ctaggatgcgcggatatgggtttatctggagtttcaaatgcaatgacttatgattataac
ttactcataatactttatgataatgagtcctcagcaaatactgatattcaggagactagt
atgacaccatttggagcgcaaacatcatttagtagacccggtaaacaaagaagaataatg
aagaaaaggtggaaaaagagcgtagtcccaatgataatagctggacataggaacgttaga
tatgcagccactatgactcctgcctatccactggactccatgaataagatcagaaaggca
ttaacgatagggggaccaacgttcattcattcgttagacccgtgcccgaagggatgggat
tacgatccgaaattctctcacgaactgggagtattggcagtagagacaggattatggcca
ctatatgaatatatagatggagagatagtgtacaatgagcctaccaagagcatagtagag
ggtagaatgaagagaaaaccagtaaaagagtacttagaaaagcaaggaagattttcacat
tttactgaagaagacattgaatacgtccaaagaatggttgacgagatgtatgaagaatgg
gaaatacctggggtaatgccaataaagtcaataaatgcgaagataagtgataaataa

DBGET integrated database retrieval system