KEGG   Shewanella oneidensis: SO_0659Help
Entry
SO_0659           CDS       T00099                                 

Definition
Mu phage lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SO_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680636..681193
Genome map
AA seq 185 aa AA seqDB search
MNSKLKAFLMAAGLSSAAITGAQLTDKWEGNSLTVYVDAVGVLTACRGHTSKDLKLGQTF
TEQECMEIFAKDIARADKQLLQLTATVRLTDSEHAAYLSFMHWAGYGNFASSTLRKKLLA
GDRVGACKELTQACSTNQQTGERVCNGWTYGTRLGVKVRLNGLIKRRAEEQAICLSELTV
GGLTQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaactcaaggcatttttaatggcagcaggcttaagttcggctgcaattact
ggcgcacagcttacagataaatgggagggcaatagcctaacggtttatgtcgatgctgta
ggtgtgctcaccgcttgccgtggccatacaagcaaagacttaaagcttgggcaaaccttt
actgagcaggagtgcatggagattttcgccaaggatatcgcccgtgccgacaagcagctg
ctgcaactcacggccactgtaaggctcactgatagtgagcacgcggcttacctgtcgttt
atgcactgggcgggatacggcaactttgccagctcaactctgcgtaaaaagctgttagct
ggggatcgtgtgggagcctgcaaggagctaacccaagcctgttctactaaccagcaaacg
ggtgagcgcgtttgcaatggttggacgtatggcacccgcctaggtgtcaaagtgcgcctt
aatggactgattaagcgccgagccgaagagcaagccatttgcctctccgaactcacagtc
ggagggttaacgcaatga

DBGET integrated database retrieval system