KEGG   Shewanella oneidensis: SO_0772Help
Entry
SO_0772           CDS       T00099                                 

Gene name
folM
Definition
(RefSeq) dihydrofolate reductase FolM
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
son  Shewanella oneidensis
Pathway
son00670  One carbon pool by folate
son00790  Folate biosynthesis
son01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SO_0772 (folM)
   00670 One carbon pool by folate
    SO_0772 (folM)
Enzymes [BR:son01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SO_0772 (folM)
    1.5.1.50  dihydromonapterin reductase
     SO_0772 (folM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR NmrA GDP_Man_Dehyd NAD_binding_10 RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 1168627
NCBI-ProteinID: NP_716403
UniProt: Q8EIR4
Position
785081..785800
Genome map
AA seq 239 aa AA seqDB search
MTAPIIITGVGKRIGYALAKHLLAQGHKVIGTYRSHYPSIDELQSLGATLIQCDFYDNAQ
VQNLIEQLSQYPKFRAIIHNASDWLADNSPEFAAHEVMQRMIQVHVNVPYQMNLALASKL
QAGAEGEIGASDIIHITDYVAEKGSAKHIAYAASKAALDNLTLSFAAKLAPEVKVNAIAP
AMILFNPSDDEAYRQKTLAKAILPKEAGNHEIIELMEYLLNSRYVTGRSHHVDGGRHLR
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcccattattatcactggcgtgggtaaacgtattggctacgccctcgcgaaa
cacttgctcgcccaagggcacaaggtgattggcacttaccgcagccattatcccagcatc
gatgagttgcagtctttgggcgcgaccttaattcaatgcgatttttacgacaatgctcaa
gtacaaaacctgattgagcaattgagccagtaccccaagtttcgcgccattatccataat
gcctctgactggctggcggataacagtcccgaatttgccgcccatgaggtgatgcagcgg
atgatacaggtacatgtgaacgtgccctatcaaatgaatttggccttggcttcgaaatta
caagcgggggccgaaggggaaattggtgctagcgatattatccatatcaccgactatgtg
gccgaaaagggcagtgcgaaacatatcgcctatgcggccagtaaagcggcgctagacaat
ttaaccttatcctttgcggctaaattagcgcccgaggtcaaagtgaatgcgattgctccg
gcgatgatcctctttaatccaagtgatgatgaagcctatcgacaaaagaccttagccaag
gctattttgccaaaagaagcgggaaatcatgagattatcgaactaatggaatatctgctt
aatagccgttatgtcaccggacgtagtcatcatgtcgatggtgggcggcatttaaggtaa

DBGET integrated database retrieval system