KEGG   Shewanella oneidensis: SO_0810Help
Entry
SO_0810           CDS       T00099                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase RbsK (EC:2.7.1.15)
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
son  Shewanella oneidensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SO_0810 (rbsK)
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SO_0810 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821797..822708)
Genome map
AA seq 303 aa AA seqDB search
MSHILVIGSANADHVMNFEYLPVPGQTLKSRSYRLEHGGKGANQAVACARLCLPDSRVDF
ICHLGQDSIGNEMRDSWLKDGIQAEGITLVDNVSTGTAMIFVADNGENAIGIAAGANAHL
TPLELEKHYALFANAQYLLIQLETPTETVSNALQMAKRLGITTVLNPAPAATQELDYLKW
VDIITPNETEAEALTGIEVKHEEDAKLAAQWLHQQGITTVVITLGSKGAFISSPGFTGLI
PALTVQAIDTVAAGDTFNGALVVGLSEGMSIAAAVSFANAASAITVTREGAQRAIPYRSE
VSR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagccatattctcgttatcggcagtgccaacgccgatcatgttatgaactttgagtat
ttgcctgttcctggacaaaccttaaaaagccgaagctatcggttagaacatggtggcaag
ggcgccaatcaggcggtcgcttgcgcccggctgtgccttcccgattctcgcgtagatttt
atctgccacttaggccaagacagcattggaaatgaaatgcgcgacagttggctcaaggat
ggcatccaagccgagggcatcaccctagtcgacaatgtgagcactggcacggcgatgatt
tttgtcgccgataatggcgaaaacgccatcgggatcgccgctggggccaatgcccatctc
accccccttgaattagaaaaacattacgccctgtttgccaatgcgcaatacctgctgatc
cagctcgaaacacccaccgaaacagttagcaatgcactccaaatggctaaacgtcttggt
ataaccacagttctcaatccagcgccagcggccactcaggagctggattacctgaaatgg
gtcgacattattacccccaatgaaaccgaggccgaagcattaacgggtattgaggtcaag
catgaagaagatgccaaactcgcggcccaatggctacatcaacaggggattaccactgtg
gtgattaccttaggtagcaaaggcgcatttattagcagccctggttttaccgggctaatc
cccgccctcactgtgcaagccatcgatacggtcgccgctggtgataccttcaacggcgcg
ctcgttgtcggcttaagtgaaggtatgtcaattgccgccgccgtcagctttgccaacgca
gcatcggcgattacggttacccgtgaaggtgcacagcgcgccatcccctaccgcagcgaa
gtatcgcgttaa

DBGET integrated database retrieval system