KEGG   Shewanella oneidensis: SO_0878Help
Entry
SO_0878           CDS       T00099                                 

Definition
phosphoribulokinase (EC:2.7.1.19)
Orthology
K00855  
phosphoribulokinase [EC:2.7.1.19]
Organism
son  Shewanella oneidensis
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_0878
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     SO_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(907976..908863)
Genome map
AA seq 295 aa AA seqDB search
MSAKHPIIAVTGSSGAGTTTTTTAFSHIFRQLGINAAFVEGDSFHHYTRAEMEVMIRKSQ
AENRNLSYFGPEANNFARLEQCFRDYGATGQGETRSYLHTFDEAVPFNQMPGTFTQWRPL
PENTDMLYYEGLHGGVVTGDANVAQHVDLLIGMVPIVNLEWIQKIIRDTSERGHSREKVM
GSIVRSMDDYIKHMTPQFSRTHINFQRVPTVDTSNPFSAKDIPSLDESFVVIRFRGINNV
DFPYYLSMIQGSFMSRVNTLVVPGGKMSLAMELILTPLIKDLMEKRQQLNSPQAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaacatcctattattgcagttacaggctcatccggcgcaggaaccacaaca
acgacaaccgcctttagtcatatttttcgccaactcgggatcaatgccgcctttgtcgaa
ggggatagttttcatcactatacccgcgcagagatggaagtgatgatccgtaaatcccaa
gcagaaaatcgcaatctgagctattttggccccgaggccaataattttgcccgtctagaa
caatgctttcgcgattatggcgccaccggccaaggtgaaacccgcagctatttacacacc
ttcgacgaggccgtgccctttaaccaaatgcccggcaccttcacccaatggcggccacta
cctgaaaataccgatatgctttattacgaaggcttacatggcggcgtagtcacaggcgat
gccaatgtagcccagcatgtcgatttactgatcggcatggtgcccatcgtaaacttagag
tggatccaaaagatcattcgtgacacctcggagcgtggccatagccgcgaaaaagtcatg
ggctcgattgtccgcagtatggacgattacattaaacacatgacgccgcaattttcgcgc
acccatatcaacttccaacgggtgccgacggtagatacctctaaccccttcagcgccaag
gatattccaagccttgatgaaagctttgtggtgatccgttttcgcggcatcaacaatgtc
gacttcccctattatttaagcatgatccaaggatcctttatgtcgcgggtcaatacccta
gttgtacccggcggcaaaatgtccttagcgatggagcttatactcacaccgctgattaag
gatttgatggaaaaacgccaacagctcaatagtcctcaagccaactaa

DBGET integrated database retrieval system