KEGG   Shewanella oneidensis: SO_0878Help
Entry
SO_0878           CDS       T00099                                 

Definition
(RefSeq) phosphoribulokinase
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
son  Shewanella oneidensis
Pathway
son01100  Metabolic pathways
son01120  Microbial metabolism in diverse environments
son01200  Carbon metabolism
Brite
Enzymes [BR:son01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     SO_0878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK SRP54 APS_kinase
Motif
Other DBs
NCBI-GeneID: 1168725
NCBI-ProteinID: NP_716509
UniProt: Q8EIG1
Position
complement(907976..908863)
Genome map
AA seq 295 aa AA seqDB search
MSAKHPIIAVTGSSGAGTTTTTTAFSHIFRQLGINAAFVEGDSFHHYTRAEMEVMIRKSQ
AENRNLSYFGPEANNFARLEQCFRDYGATGQGETRSYLHTFDEAVPFNQMPGTFTQWRPL
PENTDMLYYEGLHGGVVTGDANVAQHVDLLIGMVPIVNLEWIQKIIRDTSERGHSREKVM
GSIVRSMDDYIKHMTPQFSRTHINFQRVPTVDTSNPFSAKDIPSLDESFVVIRFRGINNV
DFPYYLSMIQGSFMSRVNTLVVPGGKMSLAMELILTPLIKDLMEKRQQLNSPQAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcaaaacatcctattattgcagttacaggctcatccggcgcaggaaccacaaca
acgacaaccgcctttagtcatatttttcgccaactcgggatcaatgccgcctttgtcgaa
ggggatagttttcatcactatacccgcgcagagatggaagtgatgatccgtaaatcccaa
gcagaaaatcgcaatctgagctattttggccccgaggccaataattttgcccgtctagaa
caatgctttcgcgattatggcgccaccggccaaggtgaaacccgcagctatttacacacc
ttcgacgaggccgtgccctttaaccaaatgcccggcaccttcacccaatggcggccacta
cctgaaaataccgatatgctttattacgaaggcttacatggcggcgtagtcacaggcgat
gccaatgtagcccagcatgtcgatttactgatcggcatggtgcccatcgtaaacttagag
tggatccaaaagatcattcgtgacacctcggagcgtggccatagccgcgaaaaagtcatg
ggctcgattgtccgcagtatggacgattacattaaacacatgacgccgcaattttcgcgc
acccatatcaacttccaacgggtgccgacggtagatacctctaaccccttcagcgccaag
gatattccaagccttgatgaaagctttgtggtgatccgttttcgcggcatcaacaatgtc
gacttcccctattatttaagcatgatccaaggatcctttatgtcgcgggtcaatacccta
gttgtacccggcggcaaaatgtccttagcgatggagcttatactcacaccgctgattaag
gatttgatggaaaaacgccaacagctcaatagtcctcaagccaactaa

DBGET integrated database retrieval system