KEGG   Shewanella oneidensis: SO_0933Help
Entry
SO_0933           CDS       T00099                                 

Gene name
fba
Definition
fructose-bisphosphate aldolase class II Calvin cycle subtype Fba (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_0933 (fba)
   01230 Biosynthesis of amino acids
    SO_0933 (fba)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_0933 (fba)
   00030 Pentose phosphate pathway
    SO_0933 (fba)
   00051 Fructose and mannose metabolism
    SO_0933 (fba)
  Energy metabolism
   00680 Methane metabolism
    SO_0933 (fba)
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SO_0933 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964252..965319
Genome map
AA seq 355 aa AA seqDB search
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMTAALEQYPDIPVCIHQDHGTDPDICQRSIQLGMSSVMMDGSLMADGKTPASYEY
NVDVTRRTVAFAHACGVSVEGEIGCLGSLETGTAGEEDGVGAEGVLSHDQLLTSPEEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQE
WLKIINQYGGQIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKYLAEHPSEFD
PRKFLKASMEAMADICTVRYEAFGCAGQASKIKPLSLQAMYKAYQSGALDPKINL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatttccctacgacaactactcgatcacgcggcagaacatggatacggtgtg
ccagcgttcaacgtaaataaccttgagcaaatgcgcgccatcatgcaggccgcagaagcc
actgatagccctgttatcgtgcaagcctctgcgggtgcgcgtaaatatgcccgtcctcag
ttcttaaaatacctgatgaccgcagcgcttgagcagtatcccgatatcccagtctgtatt
caccaagaccacggtactgaccctgatatctgtcagcgttcaattcaacttggtatgtcc
tcagtgatgatggacggatcattaatggccgatggtaaaacccctgcgtcttacgagtac
aacgttgatgtcactcgtagaaccgttgcattcgcccacgcctgtggtgtgtctgtagag
ggtgaaatcggttgtttaggtagcttagaaaccggtactgccggtgaagaagacggtgtg
ggcgcagaaggcgtattaagccacgaccaactgctgaccagcccagaagaagccgcccgc
tttgttgccgatacccatgttgacgcgctggcgattgcgattggtaccagccacggtgca
tacaagttcagtcgtaaaccgacgggtgatgtactgcgtatcgaccgtatcaaagaaatc
catgcccgcattcctaacactcatttagtgatgcatggttcatcttcagtgccacaagaa
tggcttaagatcatcaaccaatacggtggtcaaattcctgaaacttacggcgtgccatta
gaagaaatcgttgaaggtatcaaacacggcgtgcgtaaagtgaacatcgataccgacctg
cgtttagcctctaccggcgcggtacgtaaatacttggcagaacacccaagcgagttcgac
ccacgtaagttcctgaaagcctctatggaagcgatggcagacatctgtactgttcgttac
gaagccttcggttgtgcgggtcaggcttctaagattaagcctttgtctttacaagcaatg
tacaaagcttaccaatcaggtgccttagatcctaagatcaatctgtaa

DBGET integrated database retrieval system