KEGG   Shewanella oneidensis: SO_0933Help
Entry
SO_0933           CDS       T00099                                 

Gene name
fba
Definition
fructose-bisphosphate aldolase class II Calvin cycle subtype Fba (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:son01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:son01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:son00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:son00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:son00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:son00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964252..965319
Genome map
AA seq 355 aa AA seqDB search
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMTAALEQYPDIPVCIHQDHGTDPDICQRSIQLGMSSVMMDGSLMADGKTPASYEY
NVDVTRRTVAFAHACGVSVEGEIGCLGSLETGTAGEEDGVGAEGVLSHDQLLTSPEEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQE
WLKIINQYGGQIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKYLAEHPSEFD
PRKFLKASMEAMADICTVRYEAFGCAGQASKIKPLSLQAMYKAYQSGALDPKINL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatttccctacgacaactactcgatcacgcggcagaacatggatacggtgtg
ccagcgttcaacgtaaataaccttgagcaaatgcgcgccatcatgcaggccgcagaagcc
actgatagccctgttatcgtgcaagcctctgcgggtgcgcgtaaatatgcccgtcctcag
ttcttaaaatacctgatgaccgcagcgcttgagcagtatcccgatatcccagtctgtatt
caccaagaccacggtactgaccctgatatctgtcagcgttcaattcaacttggtatgtcc
tcagtgatgatggacggatcattaatggccgatggtaaaacccctgcgtcttacgagtac
aacgttgatgtcactcgtagaaccgttgcattcgcccacgcctgtggtgtgtctgtagag
ggtgaaatcggttgtttaggtagcttagaaaccggtactgccggtgaagaagacggtgtg
ggcgcagaaggcgtattaagccacgaccaactgctgaccagcccagaagaagccgcccgc
tttgttgccgatacccatgttgacgcgctggcgattgcgattggtaccagccacggtgca
tacaagttcagtcgtaaaccgacgggtgatgtactgcgtatcgaccgtatcaaagaaatc
catgcccgcattcctaacactcatttagtgatgcatggttcatcttcagtgccacaagaa
tggcttaagatcatcaaccaatacggtggtcaaattcctgaaacttacggcgtgccatta
gaagaaatcgttgaaggtatcaaacacggcgtgcgtaaagtgaacatcgataccgacctg
cgtttagcctctaccggcgcggtacgtaaatacttggcagaacacccaagcgagttcgac
ccacgtaagttcctgaaagcctctatggaagcgatggcagacatctgtactgttcgttac
gaagccttcggttgtgcgggtcaggcttctaagattaagcctttgtctttacaagcaatg
tacaaagcttaccaatcaggtgccttagatcctaagatcaatctgtaa

DBGET integrated database retrieval system