KEGG   Shewanella oneidensis: SO_0933Help
Entry
SO_0933           CDS       T00099                                 

Gene name
fba
Definition
fructose-bisphosphate aldolase class II Calvin cycle subtype Fba (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
son  Shewanella oneidensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:son00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SO_0933 (fba)
   01230 Biosynthesis of amino acids
    SO_0933 (fba)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SO_0933 (fba)
   00030 Pentose phosphate pathway
    SO_0933 (fba)
   00051 Fructose and mannose metabolism
    SO_0933 (fba)
  Energy metabolism
   00680 Methane metabolism
    SO_0933 (fba)
Enzymes [BR:son01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SO_0933 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964252..965319
Genome map
AA seq 355 aa AA seqDB search
MALISLRQLLDHAAEHGYGVPAFNVNNLEQMRAIMQAAEATDSPVIVQASAGARKYARPQ
FLKYLMTAALEQYPDIPVCIHQDHGTDPDICQRSIQLGMSSVMMDGSLMADGKTPASYEY
NVDVTRRTVAFAHACGVSVEGEIGCLGSLETGTAGEEDGVGAEGVLSHDQLLTSPEEAAR
FVADTHVDALAIAIGTSHGAYKFSRKPTGDVLRIDRIKEIHARIPNTHLVMHGSSSVPQE
WLKIINQYGGQIPETYGVPLEEIVEGIKHGVRKVNIDTDLRLASTGAVRKYLAEHPSEFD
PRKFLKASMEAMADICTVRYEAFGCAGQASKIKPLSLQAMYKAYQSGALDPKINL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggcgttaatttccctacgacaactactcgatcacgcggcagaacatggatacggtgtg
ccagcgttcaacgtaaataaccttgagcaaatgcgcgccatcatgcaggccgcagaagcc
actgatagccctgttatcgtgcaagcctctgcgggtgcgcgtaaatatgcccgtcctcag
ttcttaaaatacctgatgaccgcagcgcttgagcagtatcccgatatcccagtctgtatt
caccaagaccacggtactgaccctgatatctgtcagcgttcaattcaacttggtatgtcc
tcagtgatgatggacggatcattaatggccgatggtaaaacccctgcgtcttacgagtac
aacgttgatgtcactcgtagaaccgttgcattcgcccacgcctgtggtgtgtctgtagag
ggtgaaatcggttgtttaggtagcttagaaaccggtactgccggtgaagaagacggtgtg
ggcgcagaaggcgtattaagccacgaccaactgctgaccagcccagaagaagccgcccgc
tttgttgccgatacccatgttgacgcgctggcgattgcgattggtaccagccacggtgca
tacaagttcagtcgtaaaccgacgggtgatgtactgcgtatcgaccgtatcaaagaaatc
catgcccgcattcctaacactcatttagtgatgcatggttcatcttcagtgccacaagaa
tggcttaagatcatcaaccaatacggtggtcaaattcctgaaacttacggcgtgccatta
gaagaaatcgttgaaggtatcaaacacggcgtgcgtaaagtgaacatcgataccgacctg
cgtttagcctctaccggcgcggtacgtaaatacttggcagaacacccaagcgagttcgac
ccacgtaagttcctgaaagcctctatggaagcgatggcagacatctgtactgttcgttac
gaagccttcggttgtgcgggtcaggcttctaagattaagcctttgtctttacaagcaatg
tacaaagcttaccaatcaggtgccttagatcctaagatcaatctgtaa

DBGET integrated database retrieval system