KEGG   Shewanella oneidensis: SO_0951Help
Entry
SO_0951           CDS       T00099                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
son  Shewanella oneidensis
Brite
Enzymes [BR:son01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SO_0951 (dsbC)
Secretion system [BR:son02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SO_0951 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
987534..988259
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLVFALVVAPLASAATATTPDTAAIKQKLSEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKMFHGNLYDLDKGMKNLTEAALAGPRLAMMKPLEDHMLVYKAKDEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TEAKAGKKVSAASCDAKIAEQYQLGNSFGVNGTPAIVLEDGNMIPGYQPPEDLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacccgagcattatctttagtcttcgcgcttgttgttgcgcctctggccagc
gccgcaacggcgaccactcccgacacggctgcgattaagcaaaaactcagcgagatgtta
gatgttgaagtgatttcgatgcaggattcgcccatcgaaggtttatatcaagccatgact
aatcgcggtgtgctctatatcagccgtgatggttcaaaaatgttccatggaaatttatat
gatttagataaaggcatgaaaaacctgacagaagctgcgcttgctggcccgcgtctggcg
atgatgaagccgcttgaagatcatatgttggtgtataaagccaaggatgaaaaacatgtt
gtgacggtatttaccgatgtgagctgtggatattgccgcaagttacatagtcaaatggcc
gactacaacaagttaggtattaccgtgcgttacttagccttcccacgtgctggggtgcca
tctgccaatgccgatgaaatgcaggccatttggtgtgctaaggatccattaaaagcgatg
acagaagctaaagctggtaaaaaagtctccgctgcttcctgtgatgctaaaatcgccgag
caatatcaattaggtaatagctttggtgttaacggcaccccagccatagtactagaagat
ggcaatatgatcccaggatatcaaccacctgaagatttgctgcgtaccttagaagcgcgc
caataa

DBGET integrated database retrieval system